Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2MXR2

Protein Details
Accession A0A4V2MXR2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
22-48VVSIRPPIVYPKKKYPRTYNERKTYLYHydrophilic
NLS Segment(s)
PositionSequence
177-179KPK
197-204PGRKLKRQ
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
Amino Acid Sequences MLARLLRLPRLPSSPSSSRTYVVSIRPPIVYPKKKYPRTYNERKTYLYNQYARLLEESHSTPLIFLEHVDFAVPRLIQLRREIAAAALKHATPAPSLSSPTPAPVPPVAPALPTLKIMNGTLFGVVLRDHKPVDAEIAEAISEMVEGGFAVLSLPDLNPPQLKAVLRIMSRLVPPRKPKTPEDLKKAQEEAEKNFIPGRKLKRQRPIPVPDLRVVGALIEGRIFKAEGVKSVSELPTLDTLRAQLVGLISAPAAQLAGVLSQASGGSLARTLEGLKMSLEEKEGAGQDASTGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.49
4 0.46
5 0.43
6 0.41
7 0.41
8 0.38
9 0.37
10 0.4
11 0.38
12 0.38
13 0.38
14 0.38
15 0.43
16 0.49
17 0.52
18 0.51
19 0.58
20 0.66
21 0.74
22 0.82
23 0.83
24 0.83
25 0.85
26 0.89
27 0.88
28 0.88
29 0.84
30 0.78
31 0.74
32 0.71
33 0.7
34 0.68
35 0.61
36 0.55
37 0.55
38 0.53
39 0.47
40 0.41
41 0.33
42 0.24
43 0.24
44 0.22
45 0.19
46 0.19
47 0.17
48 0.16
49 0.15
50 0.15
51 0.11
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.08
59 0.11
60 0.11
61 0.09
62 0.13
63 0.15
64 0.17
65 0.2
66 0.22
67 0.2
68 0.21
69 0.2
70 0.17
71 0.21
72 0.18
73 0.17
74 0.15
75 0.14
76 0.14
77 0.15
78 0.14
79 0.1
80 0.11
81 0.12
82 0.12
83 0.14
84 0.14
85 0.17
86 0.16
87 0.17
88 0.18
89 0.15
90 0.16
91 0.15
92 0.15
93 0.13
94 0.16
95 0.14
96 0.13
97 0.14
98 0.14
99 0.14
100 0.14
101 0.13
102 0.11
103 0.12
104 0.12
105 0.1
106 0.09
107 0.08
108 0.07
109 0.07
110 0.06
111 0.05
112 0.06
113 0.08
114 0.09
115 0.1
116 0.1
117 0.1
118 0.11
119 0.11
120 0.12
121 0.1
122 0.08
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.03
129 0.03
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.04
143 0.05
144 0.06
145 0.06
146 0.07
147 0.08
148 0.11
149 0.11
150 0.12
151 0.16
152 0.19
153 0.19
154 0.19
155 0.19
156 0.18
157 0.21
158 0.27
159 0.27
160 0.3
161 0.38
162 0.44
163 0.5
164 0.53
165 0.54
166 0.56
167 0.63
168 0.65
169 0.65
170 0.66
171 0.61
172 0.6
173 0.58
174 0.51
175 0.46
176 0.4
177 0.36
178 0.35
179 0.32
180 0.29
181 0.31
182 0.3
183 0.27
184 0.31
185 0.35
186 0.38
187 0.48
188 0.55
189 0.63
190 0.7
191 0.77
192 0.79
193 0.79
194 0.76
195 0.75
196 0.7
197 0.63
198 0.55
199 0.46
200 0.37
201 0.29
202 0.21
203 0.14
204 0.1
205 0.08
206 0.07
207 0.07
208 0.06
209 0.07
210 0.07
211 0.07
212 0.12
213 0.12
214 0.14
215 0.18
216 0.19
217 0.19
218 0.22
219 0.23
220 0.18
221 0.18
222 0.16
223 0.18
224 0.18
225 0.18
226 0.15
227 0.15
228 0.15
229 0.16
230 0.13
231 0.09
232 0.09
233 0.09
234 0.08
235 0.08
236 0.07
237 0.07
238 0.07
239 0.05
240 0.05
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.06
255 0.07
256 0.07
257 0.08
258 0.08
259 0.1
260 0.11
261 0.12
262 0.11
263 0.12
264 0.13
265 0.14
266 0.15
267 0.14
268 0.13
269 0.16
270 0.17
271 0.16
272 0.16
273 0.14
274 0.13