Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0RBZ8

Protein Details
Accession A0A4R0RBZ8   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MSQPKEQAGRRGRGDKRKGKRREEIRQALARIBasic
NLS Segment(s)
PositionSequence
8-26AGRRGRGDKRKGKRREEIR
218-236KAGGGAAAKKGGAGSGRRK
Subcellular Location(s) mito 11, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSQPKEQAGRRGRGDKRKGKRREEIRQALARIRLNVRRLCLVFHHSLCLQVPNYDEDRPVLQRTDMSLLSALRTSPCRTSSQVAHELGQTRFVSSSPYGRTHVWKRRPKTLPNPCVPVFPQLVVRADGATYTQYITSPRSVFRLTRDTTNHPLWNTSSMIGEGDESELSGRLGRFNRRFEGLGGSGEDVKWMEGVDSGRPLTQEELDEMKKSVWANAKAGGGAAAKKGGAGSGRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.83
4 0.85
5 0.88
6 0.87
7 0.89
8 0.88
9 0.89
10 0.89
11 0.88
12 0.87
13 0.84
14 0.78
15 0.73
16 0.69
17 0.61
18 0.54
19 0.52
20 0.49
21 0.49
22 0.49
23 0.47
24 0.47
25 0.44
26 0.42
27 0.39
28 0.38
29 0.38
30 0.35
31 0.35
32 0.29
33 0.3
34 0.29
35 0.29
36 0.23
37 0.19
38 0.19
39 0.2
40 0.22
41 0.21
42 0.21
43 0.18
44 0.2
45 0.22
46 0.22
47 0.19
48 0.17
49 0.17
50 0.19
51 0.21
52 0.18
53 0.16
54 0.16
55 0.15
56 0.15
57 0.14
58 0.12
59 0.1
60 0.13
61 0.14
62 0.16
63 0.18
64 0.2
65 0.23
66 0.27
67 0.29
68 0.33
69 0.37
70 0.35
71 0.34
72 0.33
73 0.34
74 0.3
75 0.3
76 0.24
77 0.18
78 0.17
79 0.16
80 0.17
81 0.14
82 0.19
83 0.17
84 0.19
85 0.21
86 0.22
87 0.29
88 0.35
89 0.43
90 0.49
91 0.54
92 0.56
93 0.64
94 0.69
95 0.71
96 0.73
97 0.74
98 0.73
99 0.69
100 0.71
101 0.61
102 0.57
103 0.49
104 0.42
105 0.31
106 0.23
107 0.21
108 0.17
109 0.17
110 0.16
111 0.15
112 0.11
113 0.1
114 0.1
115 0.08
116 0.07
117 0.06
118 0.05
119 0.05
120 0.06
121 0.07
122 0.09
123 0.12
124 0.12
125 0.13
126 0.15
127 0.17
128 0.18
129 0.21
130 0.27
131 0.25
132 0.31
133 0.34
134 0.37
135 0.41
136 0.45
137 0.43
138 0.36
139 0.36
140 0.31
141 0.3
142 0.25
143 0.2
144 0.15
145 0.13
146 0.12
147 0.11
148 0.1
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.08
157 0.07
158 0.11
159 0.16
160 0.25
161 0.31
162 0.35
163 0.38
164 0.39
165 0.4
166 0.37
167 0.39
168 0.31
169 0.27
170 0.23
171 0.22
172 0.19
173 0.17
174 0.17
175 0.11
176 0.09
177 0.08
178 0.07
179 0.06
180 0.08
181 0.09
182 0.1
183 0.13
184 0.14
185 0.14
186 0.15
187 0.16
188 0.16
189 0.16
190 0.15
191 0.16
192 0.21
193 0.22
194 0.23
195 0.22
196 0.2
197 0.22
198 0.21
199 0.24
200 0.27
201 0.29
202 0.3
203 0.33
204 0.34
205 0.31
206 0.3
207 0.27
208 0.21
209 0.18
210 0.17
211 0.14
212 0.13
213 0.13
214 0.13
215 0.12
216 0.15