Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2MXU8

Protein Details
Accession A0A4V2MXU8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MVSVPIVKKRTKPFRRHQADRYKSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
8-52KKRTKPFRRHQADRYKSVKEAWRKPKGIDNRVRRRFKGQIPMPKI
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSVPIVKKRTKPFRRHQADRYKSVKEAWRKPKGIDNRVRRRFKGQIPMPKIGYGSNKKTRHLLPNGLKKFLVNNVREVDLLLMHNKSFAAEIAHNVSSRNRIQILERAKTLGVKVTNSAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.9
4 0.89
5 0.89
6 0.87
7 0.86
8 0.8
9 0.73
10 0.65
11 0.62
12 0.6
13 0.58
14 0.6
15 0.62
16 0.66
17 0.64
18 0.64
19 0.67
20 0.69
21 0.7
22 0.69
23 0.69
24 0.71
25 0.79
26 0.83
27 0.76
28 0.73
29 0.71
30 0.68
31 0.67
32 0.64
33 0.64
34 0.64
35 0.66
36 0.59
37 0.52
38 0.46
39 0.38
40 0.37
41 0.33
42 0.35
43 0.4
44 0.41
45 0.42
46 0.45
47 0.47
48 0.47
49 0.45
50 0.47
51 0.45
52 0.53
53 0.54
54 0.52
55 0.48
56 0.4
57 0.37
58 0.34
59 0.34
60 0.24
61 0.26
62 0.26
63 0.27
64 0.27
65 0.26
66 0.19
67 0.13
68 0.13
69 0.1
70 0.1
71 0.09
72 0.09
73 0.09
74 0.08
75 0.08
76 0.07
77 0.09
78 0.09
79 0.11
80 0.15
81 0.16
82 0.16
83 0.17
84 0.18
85 0.2
86 0.21
87 0.23
88 0.2
89 0.2
90 0.23
91 0.3
92 0.36
93 0.36
94 0.35
95 0.34
96 0.33
97 0.33
98 0.31
99 0.3
100 0.24
101 0.21
102 0.22
103 0.27
104 0.29
105 0.29
106 0.32
107 0.28