Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0RBW5

Protein Details
Accession A0A4R0RBW5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
126-146RSVPVGKKDKKRRGVVSKVKSBasic
NLS Segment(s)
PositionSequence
131-145GKKDKKRRGVVSKVK
Subcellular Location(s) nucl 17, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MDTDIPVELLITVNASSRPPVSREGYPSFEDDSHRFTEIPDNDNQLALAVANTPHHRQRPFSVDSPPYNNATLPSSHGVAHLAGYSGYQQQRGTPMRGPTWPLLGGVPEPSLRHMEEVPDDDASARSVPVGKKDKKRRGVVSKVKSLFKRGASSESQTDAPALTAYSTPESHHALAAAGMPVFDQALSPAKRLSKPGDLDSVSGALGLSSLSNTFSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.13
5 0.16
6 0.17
7 0.22
8 0.26
9 0.3
10 0.36
11 0.4
12 0.41
13 0.41
14 0.41
15 0.39
16 0.36
17 0.35
18 0.3
19 0.29
20 0.27
21 0.27
22 0.24
23 0.22
24 0.3
25 0.28
26 0.3
27 0.28
28 0.31
29 0.3
30 0.3
31 0.29
32 0.2
33 0.16
34 0.13
35 0.1
36 0.06
37 0.06
38 0.09
39 0.12
40 0.15
41 0.21
42 0.27
43 0.28
44 0.31
45 0.36
46 0.4
47 0.43
48 0.42
49 0.44
50 0.44
51 0.46
52 0.48
53 0.45
54 0.4
55 0.35
56 0.32
57 0.26
58 0.22
59 0.19
60 0.17
61 0.16
62 0.15
63 0.14
64 0.14
65 0.14
66 0.12
67 0.12
68 0.09
69 0.07
70 0.06
71 0.06
72 0.06
73 0.1
74 0.11
75 0.12
76 0.12
77 0.12
78 0.2
79 0.22
80 0.24
81 0.23
82 0.25
83 0.26
84 0.27
85 0.29
86 0.23
87 0.23
88 0.2
89 0.17
90 0.14
91 0.12
92 0.11
93 0.09
94 0.09
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.1
101 0.1
102 0.1
103 0.11
104 0.13
105 0.13
106 0.11
107 0.11
108 0.1
109 0.1
110 0.1
111 0.08
112 0.06
113 0.05
114 0.09
115 0.09
116 0.17
117 0.26
118 0.33
119 0.43
120 0.54
121 0.63
122 0.69
123 0.76
124 0.77
125 0.78
126 0.82
127 0.82
128 0.79
129 0.78
130 0.74
131 0.72
132 0.64
133 0.59
134 0.53
135 0.46
136 0.43
137 0.36
138 0.36
139 0.33
140 0.36
141 0.33
142 0.31
143 0.28
144 0.23
145 0.22
146 0.17
147 0.14
148 0.11
149 0.08
150 0.07
151 0.07
152 0.08
153 0.1
154 0.11
155 0.11
156 0.14
157 0.18
158 0.17
159 0.17
160 0.16
161 0.14
162 0.14
163 0.14
164 0.12
165 0.08
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.04
172 0.05
173 0.14
174 0.15
175 0.16
176 0.2
177 0.25
178 0.27
179 0.32
180 0.36
181 0.37
182 0.4
183 0.43
184 0.47
185 0.43
186 0.42
187 0.39
188 0.34
189 0.25
190 0.2
191 0.16
192 0.08
193 0.07
194 0.06
195 0.05
196 0.05
197 0.05
198 0.07