Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0RM04

Protein Details
Accession A0A4R0RM04    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-97LTAGRRKSRTRSKRSAASKTRSHydrophilic
NLS Segment(s)
PositionSequence
80-94RRKSRTRSKRSAASK
Subcellular Location(s) extr 14, plas 4, mito 3, nucl 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MEAYIGQDINPALVGASLVVALLLKARFSVPDDALVEEEESLPDAVGPASVRAPLSDLKPLLPATRLSSTPSNSTLTAGRRKSRTRSKRSAASKTRSSTIHSTKPPSQVPSIRRSPLRRDAPVFTPHLSTQRGSTSRSCKPRRPDVPVIHRSLRRDAPVFMPRSVPVQRTPVSIQAPAPLAPAPLPYFSTPPAPSPYPPTFFAPAPHLPAFAAPPPPMLHPGFSAPPPTYWCPPPATYPLPPLRPIAAQVYAPTLPDYWKPATRKPVELRNPADCAYIDPSCYAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.04
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.03
9 0.07
10 0.07
11 0.07
12 0.08
13 0.09
14 0.1
15 0.14
16 0.19
17 0.17
18 0.22
19 0.24
20 0.24
21 0.24
22 0.24
23 0.2
24 0.15
25 0.15
26 0.09
27 0.09
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.09
38 0.09
39 0.09
40 0.11
41 0.13
42 0.14
43 0.19
44 0.19
45 0.18
46 0.21
47 0.22
48 0.21
49 0.2
50 0.2
51 0.19
52 0.22
53 0.22
54 0.23
55 0.27
56 0.28
57 0.29
58 0.3
59 0.27
60 0.24
61 0.25
62 0.25
63 0.26
64 0.32
65 0.34
66 0.38
67 0.42
68 0.48
69 0.55
70 0.63
71 0.68
72 0.69
73 0.74
74 0.76
75 0.79
76 0.82
77 0.83
78 0.82
79 0.78
80 0.76
81 0.68
82 0.65
83 0.56
84 0.52
85 0.5
86 0.47
87 0.47
88 0.44
89 0.47
90 0.48
91 0.53
92 0.51
93 0.46
94 0.45
95 0.43
96 0.44
97 0.45
98 0.46
99 0.44
100 0.47
101 0.48
102 0.5
103 0.54
104 0.56
105 0.52
106 0.5
107 0.5
108 0.48
109 0.48
110 0.43
111 0.34
112 0.3
113 0.26
114 0.27
115 0.25
116 0.2
117 0.18
118 0.21
119 0.22
120 0.22
121 0.27
122 0.29
123 0.35
124 0.44
125 0.48
126 0.49
127 0.54
128 0.62
129 0.63
130 0.65
131 0.68
132 0.66
133 0.71
134 0.71
135 0.69
136 0.64
137 0.6
138 0.54
139 0.49
140 0.43
141 0.35
142 0.31
143 0.27
144 0.28
145 0.32
146 0.32
147 0.28
148 0.27
149 0.24
150 0.27
151 0.28
152 0.24
153 0.2
154 0.23
155 0.23
156 0.25
157 0.26
158 0.27
159 0.27
160 0.26
161 0.24
162 0.21
163 0.21
164 0.18
165 0.17
166 0.12
167 0.11
168 0.09
169 0.11
170 0.1
171 0.09
172 0.11
173 0.11
174 0.12
175 0.13
176 0.18
177 0.17
178 0.19
179 0.22
180 0.22
181 0.22
182 0.28
183 0.31
184 0.3
185 0.32
186 0.33
187 0.31
188 0.3
189 0.31
190 0.3
191 0.28
192 0.3
193 0.28
194 0.24
195 0.21
196 0.22
197 0.22
198 0.19
199 0.2
200 0.14
201 0.16
202 0.17
203 0.18
204 0.22
205 0.2
206 0.19
207 0.17
208 0.2
209 0.2
210 0.2
211 0.22
212 0.19
213 0.2
214 0.24
215 0.27
216 0.28
217 0.28
218 0.31
219 0.31
220 0.32
221 0.35
222 0.37
223 0.38
224 0.36
225 0.43
226 0.47
227 0.46
228 0.46
229 0.44
230 0.39
231 0.35
232 0.34
233 0.3
234 0.25
235 0.22
236 0.21
237 0.23
238 0.21
239 0.21
240 0.2
241 0.16
242 0.16
243 0.18
244 0.22
245 0.23
246 0.3
247 0.34
248 0.4
249 0.5
250 0.53
251 0.6
252 0.62
253 0.68
254 0.7
255 0.75
256 0.74
257 0.69
258 0.68
259 0.59
260 0.54
261 0.44
262 0.38
263 0.34
264 0.29
265 0.24