Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0R2Y7

Protein Details
Accession A0A4R0R2Y7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-35TSSSGGKAAKKKKWSKGKVKDKAVHAVHydrophilic
NLS Segment(s)
PositionSequence
12-30SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSSSGGKAAKKKKWSKGKVKDKAVHAVSLDKATFDRIMKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGQIKRIVHHSSQLIYTRSTGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.47
5 0.56
6 0.63
7 0.71
8 0.77
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.9
15 0.87
16 0.8
17 0.79
18 0.69
19 0.59
20 0.49
21 0.42
22 0.33
23 0.28
24 0.24
25 0.15
26 0.13
27 0.13
28 0.14
29 0.12
30 0.12
31 0.11
32 0.12
33 0.13
34 0.15
35 0.17
36 0.17
37 0.2
38 0.19
39 0.19
40 0.2
41 0.2
42 0.21
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.16
49 0.16
50 0.14
51 0.14
52 0.12
53 0.13
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.17
62 0.17
63 0.17
64 0.18
65 0.2
66 0.21
67 0.3
68 0.33
69 0.32
70 0.35
71 0.35
72 0.35
73 0.41
74 0.43
75 0.36
76 0.37
77 0.36
78 0.33
79 0.37
80 0.4
81 0.33
82 0.3
83 0.3
84 0.27