Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0R4T9

Protein Details
Accession A0A4R0R4T9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-103IPFPPAPKKRSLKERHYGRNTPSHydrophilic
NLS Segment(s)
PositionSequence
88-90KKR
Subcellular Location(s) mito 10.5, nucl 10, cyto_nucl 8.833, cyto_mito 8.666, cyto 5.5
Family & Domain DBs
Amino Acid Sequences SDQMSYELCTKTCASKNFKLAGIEVGGNELENGEGYEISSDNCNDATPVGMVPGAPGSPGGGKWALTLHKAISMGRSIPHIPFPPAPKKRSLKERHYGRNTPSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.53
4 0.54
5 0.56
6 0.5
7 0.44
8 0.38
9 0.32
10 0.25
11 0.18
12 0.16
13 0.12
14 0.11
15 0.09
16 0.07
17 0.05
18 0.04
19 0.05
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.06
48 0.06
49 0.06
50 0.07
51 0.09
52 0.1
53 0.11
54 0.12
55 0.1
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.12
62 0.12
63 0.15
64 0.15
65 0.15
66 0.2
67 0.2
68 0.23
69 0.26
70 0.33
71 0.4
72 0.46
73 0.48
74 0.53
75 0.59
76 0.63
77 0.7
78 0.73
79 0.72
80 0.75
81 0.82
82 0.84
83 0.85
84 0.84
85 0.8