Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L573

Protein Details
Accession E2L573    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20TRVKKRKKFAAVKRMLNPKDBasic
NLS Segment(s)
PositionSequence
3-44VKKRKKFAAVKRMLNPKDIRLKENQLKQKKKEEEGKAKAVRR
Subcellular Location(s) mito 15.5, mito_nucl 11.333, cyto_nucl 6.333, nucl 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
KEGG mpr:MPER_00900  -  
Pfam View protein in Pfam  
PF04900  Fcf1  
Amino Acid Sequences TRVKKRKKFAAVKRMLNPKDIRLKENQLKQKKKEEEGKAKAVRRVAPVASSLFLAHNTALVPPYRVLIDTNFINFSLQNKLELVSGMMDCLYAKCIPCVTDCVMAELEKLGHKYRVAFRYCAIFTFCTYVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.78
3 0.75
4 0.67
5 0.63
6 0.64
7 0.58
8 0.53
9 0.49
10 0.57
11 0.58
12 0.64
13 0.67
14 0.67
15 0.73
16 0.76
17 0.79
18 0.76
19 0.76
20 0.76
21 0.76
22 0.77
23 0.74
24 0.78
25 0.74
26 0.72
27 0.67
28 0.61
29 0.54
30 0.47
31 0.43
32 0.34
33 0.28
34 0.25
35 0.23
36 0.19
37 0.16
38 0.13
39 0.1
40 0.1
41 0.09
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.07
55 0.1
56 0.09
57 0.1
58 0.1
59 0.1
60 0.1
61 0.09
62 0.1
63 0.12
64 0.12
65 0.12
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.07
80 0.08
81 0.09
82 0.1
83 0.11
84 0.12
85 0.16
86 0.16
87 0.21
88 0.21
89 0.22
90 0.22
91 0.22
92 0.21
93 0.18
94 0.16
95 0.13
96 0.15
97 0.15
98 0.17
99 0.18
100 0.24
101 0.31
102 0.38
103 0.4
104 0.4
105 0.39
106 0.44
107 0.44
108 0.4
109 0.35
110 0.28
111 0.26