Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MXJ6

Protein Details
Accession G9MXJ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPRDHHKERPKKRLALRIARLIPBasic
NLS Segment(s)
PositionSequence
7-13KERPKKR
Subcellular Location(s) mito 9cyto 9cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPRDHHKERPKKRLALRIARLIPSFIASSCRNCIATLSALGTDDDTLVVTSDIPNTRCMGSSQPRGGPNADRDISSIPKFLVALLLGCKGWSTPSDGRVTFATHWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.81
4 0.8
5 0.75
6 0.69
7 0.61
8 0.52
9 0.42
10 0.33
11 0.27
12 0.17
13 0.18
14 0.16
15 0.18
16 0.19
17 0.21
18 0.2
19 0.19
20 0.2
21 0.17
22 0.17
23 0.15
24 0.13
25 0.11
26 0.11
27 0.11
28 0.1
29 0.08
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.08
40 0.09
41 0.1
42 0.11
43 0.11
44 0.12
45 0.12
46 0.16
47 0.21
48 0.26
49 0.28
50 0.31
51 0.32
52 0.34
53 0.34
54 0.32
55 0.29
56 0.3
57 0.28
58 0.24
59 0.24
60 0.25
61 0.28
62 0.25
63 0.22
64 0.16
65 0.16
66 0.16
67 0.14
68 0.13
69 0.09
70 0.09
71 0.09
72 0.11
73 0.1
74 0.1
75 0.1
76 0.09
77 0.1
78 0.1
79 0.16
80 0.18
81 0.23
82 0.3
83 0.3
84 0.32
85 0.32
86 0.35