Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0R6F2

Protein Details
Accession A0A4R0R6F2   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-43MDGGIVKKKKKSKSKSKDKDVPDTTBasic
NLS Segment(s)
PositionSequence
24-36VKKKKKSKSKSKD
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDYDYRPGGSLKLKGGVMDGGIVKKKKKSKSKSKDKDVPDTTSERVKELEALMREEKSTSASPSGSRHESPSASVSTDKKTAAEKRFEEVQKKRLAQRVAKLATSTHKDRVADFNNKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.26
4 0.23
5 0.18
6 0.16
7 0.15
8 0.14
9 0.19
10 0.22
11 0.24
12 0.31
13 0.38
14 0.46
15 0.55
16 0.62
17 0.68
18 0.77
19 0.85
20 0.89
21 0.92
22 0.91
23 0.86
24 0.86
25 0.79
26 0.73
27 0.65
28 0.58
29 0.49
30 0.46
31 0.4
32 0.3
33 0.26
34 0.22
35 0.19
36 0.17
37 0.19
38 0.15
39 0.18
40 0.18
41 0.18
42 0.18
43 0.16
44 0.15
45 0.14
46 0.14
47 0.11
48 0.12
49 0.12
50 0.13
51 0.15
52 0.19
53 0.19
54 0.18
55 0.19
56 0.2
57 0.2
58 0.19
59 0.19
60 0.16
61 0.14
62 0.16
63 0.16
64 0.17
65 0.18
66 0.17
67 0.16
68 0.21
69 0.28
70 0.3
71 0.36
72 0.35
73 0.37
74 0.45
75 0.47
76 0.51
77 0.48
78 0.5
79 0.51
80 0.53
81 0.54
82 0.53
83 0.57
84 0.53
85 0.55
86 0.58
87 0.53
88 0.5
89 0.45
90 0.41
91 0.4
92 0.41
93 0.38
94 0.34
95 0.35
96 0.35
97 0.36
98 0.43
99 0.44
100 0.47
101 0.45
102 0.45
103 0.44
104 0.43
105 0.41
106 0.33
107 0.27
108 0.24
109 0.25
110 0.23
111 0.22
112 0.24
113 0.26
114 0.25