Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0RT29

Protein Details
Accession A0A4R0RT29   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-120LDLRVKKTRAIRRRLTKHEESQKTLKQRKRDIHFPIRKYBasic
NLS Segment(s)
PositionSequence
84-113LRVKKTRAIRRRLTKHEESQKTLKQRKRDI
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLTELRTELLSLRVQKIAGGSAAKLTKINGVRKSIARVLTVMNQKARQNLRELYKNKKYAPLDLRVKKTRAIRRRLTKHEESQKTLKQRKRDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.54
5 0.5
6 0.49
7 0.49
8 0.52
9 0.47
10 0.44
11 0.42
12 0.34
13 0.29
14 0.24
15 0.21
16 0.16
17 0.18
18 0.18
19 0.19
20 0.18
21 0.18
22 0.18
23 0.18
24 0.15
25 0.14
26 0.11
27 0.09
28 0.12
29 0.13
30 0.13
31 0.12
32 0.12
33 0.16
34 0.21
35 0.27
36 0.27
37 0.3
38 0.32
39 0.33
40 0.37
41 0.35
42 0.31
43 0.25
44 0.22
45 0.2
46 0.23
47 0.26
48 0.24
49 0.23
50 0.24
51 0.24
52 0.3
53 0.31
54 0.26
55 0.27
56 0.29
57 0.32
58 0.38
59 0.4
60 0.43
61 0.49
62 0.53
63 0.5
64 0.53
65 0.5
66 0.5
67 0.52
68 0.52
69 0.54
70 0.55
71 0.62
72 0.6
73 0.6
74 0.57
75 0.61
76 0.62
77 0.61
78 0.63
79 0.65
80 0.7
81 0.78
82 0.83
83 0.82
84 0.8
85 0.81
86 0.83
87 0.8
88 0.75
89 0.74
90 0.72
91 0.74
92 0.75
93 0.71
94 0.7
95 0.73
96 0.76
97 0.76
98 0.78
99 0.78
100 0.8
101 0.84
102 0.78
103 0.78
104 0.75