Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0RI72

Protein Details
Accession A0A4R0RI72    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-29ANLPSGAQRPHYRKKRKFELGRQAASTHydrophilic
NLS Segment(s)
PositionSequence
12-49PHYRKKRKFELGRQAASTKLGPKRIHEVRTRGGNKKFR
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MHANLPSGAQRPHYRKKRKFELGRQAASTKLGPKRIHEVRTRGGNKKFRALRLESGNFAWASEHVTKKTRLIGVVYNASNNELVRTNTLVKSAIIQVDATPFRQWYESHYAQPVTKKGTKKDAPAEATEEKKLSNHATRSLEEKKKEAKIDPLLESQFAAGRLYATISSRPGQSGRADGYILEGKELEFYLRKIRTGKQKHAHGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.82
4 0.87
5 0.89
6 0.91
7 0.91
8 0.92
9 0.9
10 0.87
11 0.8
12 0.7
13 0.6
14 0.52
15 0.44
16 0.4
17 0.36
18 0.38
19 0.36
20 0.38
21 0.47
22 0.51
23 0.56
24 0.56
25 0.57
26 0.55
27 0.64
28 0.68
29 0.66
30 0.68
31 0.69
32 0.64
33 0.67
34 0.66
35 0.61
36 0.61
37 0.57
38 0.55
39 0.55
40 0.55
41 0.47
42 0.42
43 0.39
44 0.32
45 0.27
46 0.21
47 0.12
48 0.14
49 0.17
50 0.19
51 0.19
52 0.23
53 0.24
54 0.25
55 0.3
56 0.27
57 0.23
58 0.23
59 0.24
60 0.24
61 0.28
62 0.26
63 0.22
64 0.21
65 0.21
66 0.19
67 0.15
68 0.13
69 0.09
70 0.1
71 0.1
72 0.12
73 0.14
74 0.13
75 0.14
76 0.13
77 0.12
78 0.13
79 0.13
80 0.11
81 0.09
82 0.09
83 0.08
84 0.11
85 0.11
86 0.11
87 0.1
88 0.09
89 0.1
90 0.11
91 0.11
92 0.12
93 0.2
94 0.21
95 0.23
96 0.25
97 0.25
98 0.26
99 0.29
100 0.26
101 0.24
102 0.27
103 0.29
104 0.31
105 0.39
106 0.41
107 0.44
108 0.49
109 0.49
110 0.47
111 0.44
112 0.47
113 0.4
114 0.39
115 0.34
116 0.28
117 0.21
118 0.19
119 0.2
120 0.19
121 0.22
122 0.22
123 0.27
124 0.3
125 0.31
126 0.37
127 0.44
128 0.46
129 0.42
130 0.45
131 0.46
132 0.48
133 0.51
134 0.47
135 0.46
136 0.47
137 0.5
138 0.48
139 0.46
140 0.41
141 0.37
142 0.34
143 0.27
144 0.21
145 0.16
146 0.13
147 0.09
148 0.08
149 0.08
150 0.09
151 0.1
152 0.1
153 0.11
154 0.13
155 0.15
156 0.16
157 0.18
158 0.18
159 0.2
160 0.2
161 0.23
162 0.23
163 0.23
164 0.22
165 0.2
166 0.23
167 0.25
168 0.23
169 0.19
170 0.16
171 0.15
172 0.16
173 0.16
174 0.14
175 0.12
176 0.14
177 0.22
178 0.24
179 0.28
180 0.31
181 0.38
182 0.46
183 0.54
184 0.63
185 0.63