Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0RXL6

Protein Details
Accession A0A4R0RXL6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-104LKSLKRLLRKGKEKARKILEBasic
234-266DALIKREKAKQERLAKQKRKREEKERNEREGSABasic
NLS Segment(s)
PositionSequence
87-101SLKRLLRKGKEKARK
238-260KREKAKQERLAKQKRKREEKERN
Subcellular Location(s) mito 13.5, cyto_mito 9.833, nucl 7.5, cyto_nucl 6.833, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036265  HIT-like_sf  
IPR032566  Znf-C2HE  
Pfam View protein in Pfam  
PF11969  DcpS_C  
PF16278  zf-C2HE  
Amino Acid Sequences MAQRTILRSYARRDLDNPAEALPNSILFAHTGTTLTIYDAYPKSTFHFLVLPRLKAVATSQDGDKKEKEKEIVDAMGLGLKEGDLKSLKRLLRKGKEKARKILEPMQEAAQACVKEIEEEMIRMYGFKWDIWIGFHPVPSMEHLHLHIISADLCSTALKNKKHYNSFHPKHGFFLDLSEVLEWLDAEQTFFEMKAQLNPAEYEPFLKEDLVCFKCHKLFKNIPKLKEHLQEEFDALIKREKAKQERLAKQKRKREEKERNEREGSASTATSVAASTPKDAEDIEAVPEKKRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.5
4 0.45
5 0.38
6 0.37
7 0.34
8 0.33
9 0.25
10 0.19
11 0.16
12 0.14
13 0.13
14 0.1
15 0.11
16 0.09
17 0.09
18 0.09
19 0.08
20 0.1
21 0.09
22 0.1
23 0.11
24 0.1
25 0.16
26 0.16
27 0.19
28 0.18
29 0.19
30 0.21
31 0.24
32 0.24
33 0.2
34 0.25
35 0.23
36 0.33
37 0.37
38 0.35
39 0.31
40 0.32
41 0.3
42 0.25
43 0.25
44 0.22
45 0.2
46 0.2
47 0.23
48 0.29
49 0.31
50 0.34
51 0.36
52 0.34
53 0.35
54 0.38
55 0.38
56 0.33
57 0.35
58 0.35
59 0.32
60 0.27
61 0.23
62 0.18
63 0.17
64 0.15
65 0.11
66 0.07
67 0.06
68 0.08
69 0.07
70 0.1
71 0.1
72 0.11
73 0.15
74 0.22
75 0.25
76 0.29
77 0.36
78 0.44
79 0.51
80 0.6
81 0.66
82 0.7
83 0.78
84 0.78
85 0.8
86 0.77
87 0.72
88 0.69
89 0.67
90 0.63
91 0.55
92 0.5
93 0.42
94 0.38
95 0.34
96 0.28
97 0.23
98 0.17
99 0.14
100 0.14
101 0.12
102 0.09
103 0.09
104 0.1
105 0.07
106 0.08
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.09
116 0.09
117 0.09
118 0.11
119 0.12
120 0.14
121 0.14
122 0.14
123 0.13
124 0.13
125 0.13
126 0.13
127 0.14
128 0.1
129 0.1
130 0.11
131 0.12
132 0.11
133 0.11
134 0.09
135 0.07
136 0.07
137 0.06
138 0.05
139 0.04
140 0.04
141 0.04
142 0.04
143 0.09
144 0.16
145 0.18
146 0.24
147 0.31
148 0.38
149 0.44
150 0.48
151 0.53
152 0.58
153 0.6
154 0.63
155 0.62
156 0.56
157 0.52
158 0.49
159 0.4
160 0.29
161 0.27
162 0.19
163 0.13
164 0.13
165 0.1
166 0.09
167 0.08
168 0.08
169 0.06
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.06
178 0.06
179 0.07
180 0.07
181 0.1
182 0.13
183 0.13
184 0.13
185 0.15
186 0.16
187 0.16
188 0.15
189 0.15
190 0.13
191 0.14
192 0.14
193 0.13
194 0.12
195 0.12
196 0.2
197 0.2
198 0.21
199 0.21
200 0.24
201 0.3
202 0.35
203 0.37
204 0.38
205 0.46
206 0.54
207 0.64
208 0.68
209 0.66
210 0.67
211 0.68
212 0.65
213 0.64
214 0.58
215 0.52
216 0.47
217 0.44
218 0.4
219 0.36
220 0.31
221 0.24
222 0.21
223 0.21
224 0.2
225 0.22
226 0.27
227 0.35
228 0.41
229 0.49
230 0.57
231 0.63
232 0.7
233 0.79
234 0.84
235 0.85
236 0.87
237 0.87
238 0.88
239 0.89
240 0.89
241 0.9
242 0.9
243 0.91
244 0.92
245 0.92
246 0.9
247 0.83
248 0.74
249 0.67
250 0.59
251 0.51
252 0.42
253 0.32
254 0.25
255 0.21
256 0.19
257 0.15
258 0.12
259 0.1
260 0.11
261 0.11
262 0.13
263 0.13
264 0.14
265 0.15
266 0.15
267 0.16
268 0.15
269 0.15
270 0.17
271 0.23
272 0.24
273 0.28