Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0R2T2

Protein Details
Accession A0A4R0R2T2    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-29ITDPIGRRVPRCRPKARRSSSSTPFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MAHITDPIGRRVPRCRPKARRSSSSTPFIGIKPRVPTLPPLVIRPSVLAARRASKAGFQDSASKSAAFAAAASFSDPNNDSEQQEEEIEWTIRIVPKHGESVYPRSKYGVVGRDSSETSVYTEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.73
4 0.81
5 0.88
6 0.89
7 0.87
8 0.86
9 0.86
10 0.82
11 0.78
12 0.69
13 0.6
14 0.53
15 0.45
16 0.44
17 0.37
18 0.34
19 0.3
20 0.31
21 0.3
22 0.29
23 0.31
24 0.29
25 0.34
26 0.3
27 0.29
28 0.3
29 0.29
30 0.29
31 0.25
32 0.21
33 0.18
34 0.18
35 0.19
36 0.18
37 0.2
38 0.21
39 0.21
40 0.2
41 0.19
42 0.2
43 0.2
44 0.19
45 0.17
46 0.23
47 0.23
48 0.26
49 0.24
50 0.21
51 0.18
52 0.17
53 0.16
54 0.08
55 0.07
56 0.05
57 0.04
58 0.05
59 0.05
60 0.06
61 0.05
62 0.07
63 0.08
64 0.1
65 0.13
66 0.15
67 0.14
68 0.15
69 0.17
70 0.16
71 0.16
72 0.14
73 0.11
74 0.12
75 0.12
76 0.11
77 0.09
78 0.11
79 0.13
80 0.13
81 0.14
82 0.15
83 0.17
84 0.22
85 0.22
86 0.25
87 0.27
88 0.36
89 0.43
90 0.42
91 0.4
92 0.38
93 0.39
94 0.38
95 0.41
96 0.39
97 0.33
98 0.34
99 0.36
100 0.37
101 0.37
102 0.35
103 0.29
104 0.22