Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0R559

Protein Details
Accession A0A4R0R559   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
155-177GLVVGRRPRRSKKQRSRVFKAGSHydrophilic
248-277YEMVGRPIPKRRTRRGKKNKARQPEAESENHydrophilic
NLS Segment(s)
PositionSequence
160-171RRPRRSKKQRSR
253-270RPIPKRRTRRGKKNKARQ
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, pero 3
Family & Domain DBs
Amino Acid Sequences MVTGRLRAPDPGTEGTTQAGNTPDNMEDDSLKAPVTHLCQLPISAKPANYEAVKAVTEARRIVWGGRQIFFNLPQTYLVYYGDTQEAGTKVEIDNIALVLYQPLAGPTVKDPDYAAADTAGPEELALVLYRPLSKPSVTRFYITPDGIAYEFVDGLVVGRRPRRSKKQRSRVFKAGSLALVLYDTRKSRIADCRKFYGTPAGVVHAVVESLADTTGLDDLPVVLYRPLCIAPPVGYRKYYVTPAGVAYEMVGRPIPKRRTRRGKKNKARQPEAESENKENEEPQQKVQPKEKVRVQQPKTPWSRRWCSAQRKAALAAGDAPGSPTAATDSTGSPLGCLASN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.26
4 0.22
5 0.19
6 0.18
7 0.15
8 0.15
9 0.17
10 0.17
11 0.17
12 0.18
13 0.17
14 0.15
15 0.17
16 0.17
17 0.15
18 0.14
19 0.12
20 0.12
21 0.15
22 0.19
23 0.22
24 0.22
25 0.24
26 0.24
27 0.26
28 0.28
29 0.27
30 0.27
31 0.25
32 0.24
33 0.25
34 0.26
35 0.28
36 0.26
37 0.25
38 0.21
39 0.21
40 0.2
41 0.18
42 0.22
43 0.21
44 0.23
45 0.23
46 0.22
47 0.22
48 0.22
49 0.23
50 0.23
51 0.27
52 0.28
53 0.29
54 0.29
55 0.28
56 0.3
57 0.32
58 0.33
59 0.26
60 0.24
61 0.23
62 0.23
63 0.22
64 0.2
65 0.18
66 0.13
67 0.13
68 0.13
69 0.13
70 0.11
71 0.11
72 0.12
73 0.12
74 0.11
75 0.11
76 0.1
77 0.1
78 0.13
79 0.13
80 0.1
81 0.1
82 0.09
83 0.08
84 0.07
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.06
92 0.06
93 0.07
94 0.08
95 0.13
96 0.13
97 0.13
98 0.13
99 0.14
100 0.17
101 0.16
102 0.15
103 0.11
104 0.11
105 0.1
106 0.11
107 0.08
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.06
118 0.07
119 0.09
120 0.1
121 0.11
122 0.15
123 0.2
124 0.27
125 0.27
126 0.28
127 0.27
128 0.3
129 0.34
130 0.3
131 0.25
132 0.18
133 0.18
134 0.16
135 0.16
136 0.11
137 0.06
138 0.06
139 0.05
140 0.05
141 0.04
142 0.04
143 0.05
144 0.06
145 0.08
146 0.12
147 0.17
148 0.23
149 0.31
150 0.42
151 0.51
152 0.62
153 0.71
154 0.78
155 0.83
156 0.87
157 0.88
158 0.86
159 0.78
160 0.7
161 0.61
162 0.51
163 0.42
164 0.32
165 0.23
166 0.14
167 0.1
168 0.07
169 0.06
170 0.07
171 0.08
172 0.09
173 0.12
174 0.13
175 0.17
176 0.27
177 0.37
178 0.43
179 0.46
180 0.5
181 0.5
182 0.5
183 0.46
184 0.44
185 0.34
186 0.28
187 0.25
188 0.22
189 0.19
190 0.18
191 0.17
192 0.09
193 0.08
194 0.05
195 0.05
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.04
203 0.04
204 0.04
205 0.03
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.06
212 0.06
213 0.08
214 0.08
215 0.08
216 0.09
217 0.09
218 0.11
219 0.18
220 0.23
221 0.24
222 0.25
223 0.26
224 0.28
225 0.3
226 0.3
227 0.26
228 0.21
229 0.2
230 0.2
231 0.2
232 0.16
233 0.14
234 0.11
235 0.12
236 0.1
237 0.1
238 0.1
239 0.1
240 0.13
241 0.23
242 0.31
243 0.37
244 0.47
245 0.57
246 0.68
247 0.78
248 0.86
249 0.89
250 0.92
251 0.94
252 0.95
253 0.94
254 0.94
255 0.91
256 0.87
257 0.83
258 0.81
259 0.75
260 0.73
261 0.68
262 0.62
263 0.57
264 0.51
265 0.44
266 0.36
267 0.37
268 0.37
269 0.34
270 0.34
271 0.39
272 0.44
273 0.5
274 0.58
275 0.6
276 0.58
277 0.65
278 0.69
279 0.69
280 0.73
281 0.77
282 0.74
283 0.73
284 0.74
285 0.75
286 0.77
287 0.77
288 0.74
289 0.73
290 0.76
291 0.73
292 0.76
293 0.76
294 0.77
295 0.79
296 0.8
297 0.75
298 0.71
299 0.68
300 0.61
301 0.52
302 0.42
303 0.34
304 0.26
305 0.21
306 0.17
307 0.16
308 0.13
309 0.12
310 0.11
311 0.08
312 0.1
313 0.1
314 0.11
315 0.12
316 0.13
317 0.15
318 0.18
319 0.17
320 0.15
321 0.15