Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8LNX1

Protein Details
Accession J8LNX1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-35LSEAYGPLKPKNKTKKKKNETKSDADSDTHydrophilic
NLS Segment(s)
PositionSequence
15-24KPKNKTKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MVLHKYLSEAYGPLKPKNKTKKKKNETKSDADSDTPSLIVKERLSTLQQEVQKSEATPIDKSCKQYNKNVWKNLETNVLSHTVAHPFTTAATGGGDRGDVGETNTQRSIDIVTNKPKTRETIYRDAQGHKIRDNDRGNAFAVSRPKSEEDEALEREQYLRALNMGDVQKLGINVDAHEKEKNRATSSLAIEDPAMRFTPDEKIGPRTSVLGRKLYDKVAPENRFGITPGSRWDGVQRSNGFEEKWFAKQNEINEKKVQSYTLQEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.5
4 0.6
5 0.68
6 0.73
7 0.81
8 0.85
9 0.89
10 0.94
11 0.95
12 0.95
13 0.92
14 0.9
15 0.87
16 0.82
17 0.74
18 0.65
19 0.57
20 0.47
21 0.39
22 0.3
23 0.22
24 0.16
25 0.15
26 0.16
27 0.15
28 0.15
29 0.16
30 0.19
31 0.21
32 0.23
33 0.26
34 0.29
35 0.32
36 0.32
37 0.32
38 0.31
39 0.3
40 0.27
41 0.26
42 0.23
43 0.22
44 0.21
45 0.24
46 0.29
47 0.31
48 0.35
49 0.4
50 0.45
51 0.47
52 0.55
53 0.62
54 0.65
55 0.71
56 0.75
57 0.71
58 0.67
59 0.65
60 0.58
61 0.56
62 0.45
63 0.37
64 0.31
65 0.28
66 0.23
67 0.21
68 0.2
69 0.14
70 0.14
71 0.13
72 0.12
73 0.09
74 0.1
75 0.1
76 0.09
77 0.06
78 0.07
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.04
87 0.06
88 0.11
89 0.11
90 0.14
91 0.14
92 0.14
93 0.14
94 0.14
95 0.15
96 0.13
97 0.18
98 0.2
99 0.28
100 0.34
101 0.36
102 0.37
103 0.36
104 0.36
105 0.36
106 0.4
107 0.39
108 0.42
109 0.43
110 0.48
111 0.49
112 0.48
113 0.49
114 0.46
115 0.41
116 0.34
117 0.37
118 0.33
119 0.39
120 0.4
121 0.37
122 0.33
123 0.33
124 0.31
125 0.26
126 0.24
127 0.18
128 0.21
129 0.18
130 0.18
131 0.18
132 0.19
133 0.2
134 0.21
135 0.2
136 0.19
137 0.21
138 0.23
139 0.22
140 0.2
141 0.18
142 0.17
143 0.16
144 0.13
145 0.09
146 0.07
147 0.07
148 0.07
149 0.07
150 0.11
151 0.12
152 0.11
153 0.11
154 0.11
155 0.11
156 0.11
157 0.11
158 0.08
159 0.08
160 0.08
161 0.14
162 0.15
163 0.16
164 0.2
165 0.21
166 0.22
167 0.28
168 0.31
169 0.28
170 0.28
171 0.3
172 0.32
173 0.34
174 0.34
175 0.27
176 0.24
177 0.22
178 0.22
179 0.19
180 0.15
181 0.12
182 0.09
183 0.09
184 0.1
185 0.15
186 0.16
187 0.19
188 0.2
189 0.26
190 0.27
191 0.28
192 0.27
193 0.26
194 0.28
195 0.32
196 0.33
197 0.33
198 0.32
199 0.36
200 0.38
201 0.37
202 0.36
203 0.32
204 0.37
205 0.41
206 0.43
207 0.41
208 0.4
209 0.39
210 0.36
211 0.33
212 0.3
213 0.21
214 0.21
215 0.22
216 0.25
217 0.24
218 0.24
219 0.29
220 0.31
221 0.32
222 0.39
223 0.37
224 0.37
225 0.4
226 0.42
227 0.37
228 0.32
229 0.34
230 0.29
231 0.33
232 0.35
233 0.32
234 0.37
235 0.4
236 0.46
237 0.52
238 0.54
239 0.53
240 0.52
241 0.54
242 0.51
243 0.49
244 0.43
245 0.35
246 0.38