Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8Q8Q1

Protein Details
Accession J8Q8Q1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28LTETEKRRLLRERRQKKFSNGGASSHydrophilic
NLS Segment(s)
PositionSequence
14-18RERRQ
Subcellular Location(s) plas 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014802  GET2  
IPR028143  Get2/sif1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0043529  C:GET complex  
GO:0000139  C:Golgi membrane  
GO:0045048  P:protein insertion into ER membrane  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MTDLTETEKRRLLRERRQKKFSNGGASSRLNKITGQASSHLNAESPLDSPSTETTTPVESLRSSTPDNREDKNTAPQLDLLKQLAAMQAQGAGTDPALDSSTPDLLSLLSSMNGGMPSAEGTPSLGQAPPLAGINQAALDYHDYLLNRLKAWTILVKWVFFLLPYLYLITRPSTAMWPADAFTQSSWFAPLRNPSNFTRVFGTFEFLSISIYYQLLKNVEHKSKIRNLQDTNKLVKLVSLVPEGVLPIPNLKGKLVTVLQYWDLLSMLITDISFVLIVLGLLTYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.78
4 0.85
5 0.87
6 0.86
7 0.86
8 0.83
9 0.82
10 0.75
11 0.7
12 0.68
13 0.64
14 0.59
15 0.53
16 0.47
17 0.37
18 0.33
19 0.32
20 0.3
21 0.28
22 0.26
23 0.25
24 0.26
25 0.27
26 0.28
27 0.24
28 0.2
29 0.17
30 0.17
31 0.14
32 0.12
33 0.11
34 0.1
35 0.1
36 0.12
37 0.13
38 0.16
39 0.16
40 0.16
41 0.17
42 0.18
43 0.19
44 0.18
45 0.18
46 0.13
47 0.16
48 0.17
49 0.19
50 0.2
51 0.25
52 0.3
53 0.36
54 0.4
55 0.4
56 0.43
57 0.43
58 0.43
59 0.46
60 0.45
61 0.39
62 0.36
63 0.36
64 0.34
65 0.32
66 0.32
67 0.24
68 0.18
69 0.17
70 0.17
71 0.15
72 0.12
73 0.09
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.06
82 0.05
83 0.05
84 0.06
85 0.05
86 0.06
87 0.07
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.04
108 0.05
109 0.06
110 0.06
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.05
127 0.06
128 0.06
129 0.07
130 0.07
131 0.08
132 0.12
133 0.12
134 0.12
135 0.11
136 0.11
137 0.1
138 0.11
139 0.13
140 0.1
141 0.15
142 0.15
143 0.15
144 0.15
145 0.15
146 0.14
147 0.11
148 0.12
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.09
157 0.09
158 0.09
159 0.09
160 0.1
161 0.11
162 0.11
163 0.11
164 0.1
165 0.1
166 0.11
167 0.11
168 0.1
169 0.09
170 0.1
171 0.1
172 0.1
173 0.12
174 0.1
175 0.11
176 0.13
177 0.2
178 0.23
179 0.25
180 0.29
181 0.29
182 0.36
183 0.36
184 0.35
185 0.32
186 0.27
187 0.28
188 0.25
189 0.26
190 0.19
191 0.19
192 0.18
193 0.14
194 0.14
195 0.1
196 0.11
197 0.08
198 0.09
199 0.09
200 0.09
201 0.11
202 0.11
203 0.13
204 0.18
205 0.24
206 0.29
207 0.35
208 0.37
209 0.42
210 0.49
211 0.56
212 0.58
213 0.59
214 0.6
215 0.64
216 0.7
217 0.69
218 0.66
219 0.59
220 0.53
221 0.44
222 0.38
223 0.32
224 0.25
225 0.22
226 0.18
227 0.16
228 0.16
229 0.16
230 0.16
231 0.14
232 0.13
233 0.1
234 0.1
235 0.13
236 0.15
237 0.16
238 0.16
239 0.17
240 0.16
241 0.21
242 0.21
243 0.21
244 0.2
245 0.22
246 0.22
247 0.22
248 0.22
249 0.16
250 0.14
251 0.12
252 0.1
253 0.08
254 0.07
255 0.07
256 0.07
257 0.06
258 0.06
259 0.07
260 0.07
261 0.06
262 0.05
263 0.05
264 0.05
265 0.04