Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8PW70

Protein Details
Accession J8PW70   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-76GHFSRRRSSHHHGRPKIKHNKPKVTTBasic
NLS Segment(s)
PositionSequence
55-72RRRSSHHHGRPKIKHNKP
Subcellular Location(s) cyto 17, nucl 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031456  Caf20  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005845  C:mRNA cap binding complex  
GO:0003743  F:translation initiation factor activity  
GO:0017148  P:negative regulation of translation  
Pfam View protein in Pfam  
PF17052  CAF20  
Amino Acid Sequences MIKYTIDELFLLKPSVTLEVNFDAVEFRAIIEKVKQLQHLKEEEFGTHHAGHFSRRRSSHHHGRPKIKHNKPKVTTDSDGWCTFEAKKKGSGEEDEEEAETTPTSTAPAVTIAQETLKVKPNNKNISSNRPADTRDIVADKPILGFNAFAALESEDEDEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.15
4 0.13
5 0.15
6 0.16
7 0.17
8 0.16
9 0.15
10 0.13
11 0.12
12 0.13
13 0.09
14 0.07
15 0.1
16 0.1
17 0.12
18 0.13
19 0.17
20 0.21
21 0.24
22 0.31
23 0.32
24 0.36
25 0.41
26 0.43
27 0.4
28 0.39
29 0.37
30 0.31
31 0.28
32 0.26
33 0.24
34 0.2
35 0.18
36 0.17
37 0.16
38 0.21
39 0.25
40 0.28
41 0.31
42 0.33
43 0.37
44 0.43
45 0.52
46 0.57
47 0.61
48 0.67
49 0.69
50 0.76
51 0.8
52 0.82
53 0.84
54 0.83
55 0.82
56 0.81
57 0.83
58 0.77
59 0.77
60 0.72
61 0.68
62 0.61
63 0.54
64 0.48
65 0.41
66 0.38
67 0.3
68 0.25
69 0.19
70 0.19
71 0.23
72 0.22
73 0.2
74 0.24
75 0.24
76 0.26
77 0.27
78 0.28
79 0.26
80 0.25
81 0.24
82 0.2
83 0.19
84 0.18
85 0.15
86 0.13
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.07
96 0.07
97 0.07
98 0.08
99 0.08
100 0.08
101 0.11
102 0.11
103 0.13
104 0.21
105 0.24
106 0.29
107 0.37
108 0.47
109 0.54
110 0.57
111 0.64
112 0.61
113 0.68
114 0.68
115 0.64
116 0.58
117 0.51
118 0.49
119 0.44
120 0.41
121 0.33
122 0.31
123 0.29
124 0.27
125 0.26
126 0.25
127 0.21
128 0.19
129 0.18
130 0.15
131 0.12
132 0.12
133 0.1
134 0.13
135 0.12
136 0.11
137 0.12
138 0.11
139 0.11
140 0.12
141 0.14