Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LX87

Protein Details
Accession E2LX87    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSLPEDKERPKKRREHTVQQSWEKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, plas 6, mito 4, cyto 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045338  DUF6535  
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_11889  -  
Pfam View protein in Pfam  
PF20153  DUF6535  
Amino Acid Sequences MSSVEQSLPEDKERPKKRREHTVQQSWEKLMAEVEQYDDGMVKNWKEDIDTLLVFAGLFSAVVTAFLIESYQWLSEDPADTTGALLTQISMQLNTSQTMSMFPQHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.69
4 0.74
5 0.8
6 0.82
7 0.83
8 0.83
9 0.86
10 0.86
11 0.83
12 0.78
13 0.68
14 0.61
15 0.5
16 0.39
17 0.29
18 0.2
19 0.14
20 0.11
21 0.12
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.09
29 0.08
30 0.08
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.11
37 0.11
38 0.1
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.05
59 0.05
60 0.06
61 0.07
62 0.08
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.07
72 0.06
73 0.05
74 0.05
75 0.07
76 0.07
77 0.08
78 0.09
79 0.11
80 0.13
81 0.14
82 0.14
83 0.12
84 0.12
85 0.14
86 0.15