Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4YD91

Protein Details
Accession A0A4Q4YD91    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
208-233IEKKLSERARERWRRLKRPQCFKAASHydrophilic
NLS Segment(s)
PositionSequence
211-225KLSERARERWRRLKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSEHHREVVRIRLVQELRQLDQTHRMIAMLLECEHPDWGDPGAEAAHKAALDIVRETFRTRSKLSPQEISEIRKKDRERAGLSRSIAQLPSHKFSQSNDFARPVRSLQPSSVESIKDKHIASNAPDPKDITLPMDDDDNLQVHQAELSIPLCVDASVSCTALANRAHAGAMRRLDRCPVTPSGLAELEAKRTSVWNRISQIDAAQKEIEKKLSERARERWRRLKRPQCFKAASLGLSRGRGSRLSSYTAIDDADDPFGERNTWCEREVLWEPELKPRDREVTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.43
4 0.39
5 0.42
6 0.42
7 0.36
8 0.43
9 0.41
10 0.35
11 0.31
12 0.29
13 0.23
14 0.22
15 0.21
16 0.15
17 0.14
18 0.13
19 0.14
20 0.14
21 0.14
22 0.13
23 0.12
24 0.11
25 0.11
26 0.1
27 0.09
28 0.09
29 0.1
30 0.1
31 0.1
32 0.09
33 0.1
34 0.09
35 0.09
36 0.1
37 0.11
38 0.12
39 0.13
40 0.14
41 0.15
42 0.16
43 0.18
44 0.2
45 0.24
46 0.27
47 0.29
48 0.34
49 0.41
50 0.5
51 0.52
52 0.55
53 0.51
54 0.54
55 0.55
56 0.53
57 0.52
58 0.48
59 0.47
60 0.47
61 0.48
62 0.49
63 0.53
64 0.55
65 0.55
66 0.57
67 0.59
68 0.58
69 0.58
70 0.53
71 0.47
72 0.4
73 0.34
74 0.28
75 0.29
76 0.27
77 0.29
78 0.26
79 0.25
80 0.24
81 0.25
82 0.32
83 0.33
84 0.33
85 0.32
86 0.34
87 0.34
88 0.35
89 0.35
90 0.29
91 0.28
92 0.29
93 0.27
94 0.24
95 0.28
96 0.27
97 0.28
98 0.28
99 0.23
100 0.2
101 0.2
102 0.21
103 0.21
104 0.2
105 0.18
106 0.19
107 0.19
108 0.21
109 0.29
110 0.31
111 0.29
112 0.29
113 0.29
114 0.27
115 0.26
116 0.23
117 0.15
118 0.11
119 0.1
120 0.1
121 0.1
122 0.09
123 0.09
124 0.09
125 0.08
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.05
134 0.05
135 0.05
136 0.04
137 0.05
138 0.05
139 0.04
140 0.05
141 0.03
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.11
149 0.12
150 0.1
151 0.1
152 0.1
153 0.1
154 0.11
155 0.13
156 0.14
157 0.17
158 0.2
159 0.21
160 0.21
161 0.25
162 0.25
163 0.25
164 0.25
165 0.24
166 0.24
167 0.23
168 0.24
169 0.23
170 0.22
171 0.21
172 0.2
173 0.18
174 0.17
175 0.16
176 0.16
177 0.13
178 0.15
179 0.17
180 0.22
181 0.25
182 0.28
183 0.3
184 0.32
185 0.33
186 0.31
187 0.33
188 0.32
189 0.28
190 0.25
191 0.23
192 0.23
193 0.25
194 0.26
195 0.25
196 0.2
197 0.21
198 0.28
199 0.33
200 0.4
201 0.42
202 0.5
203 0.58
204 0.66
205 0.74
206 0.75
207 0.8
208 0.83
209 0.87
210 0.89
211 0.88
212 0.89
213 0.87
214 0.87
215 0.8
216 0.71
217 0.68
218 0.61
219 0.53
220 0.44
221 0.42
222 0.35
223 0.33
224 0.33
225 0.26
226 0.25
227 0.24
228 0.25
229 0.27
230 0.27
231 0.3
232 0.3
233 0.31
234 0.3
235 0.29
236 0.25
237 0.2
238 0.18
239 0.14
240 0.14
241 0.12
242 0.12
243 0.12
244 0.12
245 0.13
246 0.12
247 0.15
248 0.21
249 0.24
250 0.24
251 0.24
252 0.24
253 0.3
254 0.36
255 0.36
256 0.3
257 0.33
258 0.34
259 0.42
260 0.48
261 0.43
262 0.41
263 0.42