Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Y2J5

Protein Details
Accession A0A4Q4Y2J5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-57RGRGRGATGKRPRHRNRTGAPRRYIBasic
151-170DAVGMKRKTGDGRKKGNRRSBasic
NLS Segment(s)
PositionSequence
33-54RGRGRGATGKRPRHRNRTGAPR
156-170KRKTGDGRKKGNRRS
Subcellular Location(s) mito 18.5, mito_nucl 12.833, nucl 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
Amino Acid Sequences MMIPLPRFPSVITASKFRKGNEMADKQDDSLARGRGRGATGKRPRHRNRTGAPRRYISTNGPGGTSSRTSGIASAPRPRGIISGEPPLTGGGYMLHGPRDKGKTSLSRPLAGVFGLGLYVLKMQSVSGDTILEGVFQELPPYCIVLLEDIDAVGMKRKTGDGRKKGNRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.49
4 0.44
5 0.47
6 0.42
7 0.48
8 0.5
9 0.54
10 0.52
11 0.54
12 0.54
13 0.47
14 0.47
15 0.39
16 0.32
17 0.29
18 0.29
19 0.25
20 0.24
21 0.25
22 0.24
23 0.26
24 0.3
25 0.3
26 0.35
27 0.44
28 0.54
29 0.61
30 0.7
31 0.76
32 0.79
33 0.83
34 0.81
35 0.8
36 0.81
37 0.84
38 0.82
39 0.79
40 0.72
41 0.66
42 0.6
43 0.55
44 0.47
45 0.42
46 0.37
47 0.32
48 0.28
49 0.26
50 0.24
51 0.23
52 0.2
53 0.14
54 0.11
55 0.11
56 0.11
57 0.11
58 0.12
59 0.14
60 0.15
61 0.21
62 0.22
63 0.22
64 0.22
65 0.22
66 0.21
67 0.18
68 0.19
69 0.15
70 0.2
71 0.19
72 0.19
73 0.19
74 0.18
75 0.16
76 0.12
77 0.1
78 0.04
79 0.04
80 0.06
81 0.06
82 0.08
83 0.08
84 0.09
85 0.13
86 0.16
87 0.17
88 0.18
89 0.22
90 0.28
91 0.32
92 0.41
93 0.39
94 0.37
95 0.37
96 0.36
97 0.32
98 0.24
99 0.19
100 0.1
101 0.07
102 0.05
103 0.05
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.07
123 0.06
124 0.08
125 0.08
126 0.09
127 0.09
128 0.1
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.07
137 0.08
138 0.08
139 0.07
140 0.12
141 0.12
142 0.11
143 0.13
144 0.16
145 0.25
146 0.36
147 0.46
148 0.5
149 0.61
150 0.72