Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8LK59

Protein Details
Accession J8LK59   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-76GIYIRIRHKPMKNVLRRENSFNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 6, mito 4, golg 3
Family & Domain DBs
Gene Ontology GO:0030659  C:cytoplasmic vesicle membrane  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0000139  C:Golgi membrane  
GO:0008643  P:carbohydrate transport  
Pfam View protein in Pfam  
PF16913  PUNUT  
Amino Acid Sequences MNRTLFLTFLFGWYFCSIALSVYNRWMFDPKDGLGIEYPVLVTTFHQAVLWLLSGIYIRIRHKPMKNVLRRENSFNWSFFLKFLVPTAIASAGDIGLSNVSFQYVPLTIYTIIKSSSIAFVLLFGCIFKLERFHWKLALSVIIMFGGVALMVFNPNASSYTDNKQSLVIFGSLLVLASSCLSGLRWVYTQLLLRNNSMHKTVMTVAESDGTPFTENEDNADDDIAINSANIKGVENLRGIKPHPIHTIHQLAPIMGVSLLLTSLVVEKPFPGIFESTLFKFAVDSGSSDTETNVFSIAKGVFLLILPGFAVFLLTICEFSILEQTPVLTVSIAGIVKEVLTVIFGMIILSERLSGFYNWLGMIIIMADVCYYNYFRYEQDSKQKYQSGSVQDGDGDLKGFPDFEQLGSRKSGPYSIIVDSTNQEYELDMIAQNANRSSQQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.14
4 0.12
5 0.12
6 0.17
7 0.17
8 0.18
9 0.25
10 0.27
11 0.26
12 0.28
13 0.32
14 0.29
15 0.3
16 0.33
17 0.27
18 0.31
19 0.3
20 0.3
21 0.26
22 0.26
23 0.21
24 0.17
25 0.16
26 0.1
27 0.1
28 0.09
29 0.08
30 0.11
31 0.12
32 0.11
33 0.11
34 0.11
35 0.12
36 0.13
37 0.13
38 0.09
39 0.07
40 0.08
41 0.08
42 0.09
43 0.11
44 0.14
45 0.17
46 0.24
47 0.31
48 0.39
49 0.45
50 0.54
51 0.62
52 0.68
53 0.75
54 0.78
55 0.81
56 0.82
57 0.8
58 0.79
59 0.74
60 0.7
61 0.64
62 0.54
63 0.47
64 0.39
65 0.36
66 0.28
67 0.25
68 0.2
69 0.16
70 0.17
71 0.17
72 0.15
73 0.14
74 0.15
75 0.13
76 0.12
77 0.11
78 0.1
79 0.07
80 0.07
81 0.07
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.05
89 0.05
90 0.08
91 0.08
92 0.08
93 0.08
94 0.11
95 0.11
96 0.12
97 0.13
98 0.12
99 0.12
100 0.11
101 0.12
102 0.11
103 0.11
104 0.1
105 0.1
106 0.08
107 0.09
108 0.09
109 0.09
110 0.07
111 0.06
112 0.06
113 0.06
114 0.07
115 0.06
116 0.09
117 0.11
118 0.21
119 0.26
120 0.28
121 0.3
122 0.3
123 0.31
124 0.29
125 0.28
126 0.18
127 0.14
128 0.13
129 0.09
130 0.09
131 0.07
132 0.06
133 0.04
134 0.03
135 0.02
136 0.02
137 0.02
138 0.03
139 0.03
140 0.03
141 0.03
142 0.04
143 0.05
144 0.06
145 0.1
146 0.12
147 0.17
148 0.24
149 0.24
150 0.24
151 0.24
152 0.23
153 0.21
154 0.2
155 0.15
156 0.09
157 0.09
158 0.09
159 0.07
160 0.07
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.05
170 0.05
171 0.06
172 0.06
173 0.08
174 0.09
175 0.11
176 0.13
177 0.16
178 0.21
179 0.21
180 0.21
181 0.24
182 0.24
183 0.24
184 0.23
185 0.2
186 0.14
187 0.15
188 0.15
189 0.14
190 0.13
191 0.12
192 0.11
193 0.11
194 0.11
195 0.1
196 0.08
197 0.07
198 0.07
199 0.06
200 0.09
201 0.1
202 0.1
203 0.11
204 0.12
205 0.12
206 0.11
207 0.11
208 0.09
209 0.06
210 0.07
211 0.05
212 0.04
213 0.03
214 0.03
215 0.04
216 0.04
217 0.04
218 0.05
219 0.06
220 0.07
221 0.1
222 0.11
223 0.13
224 0.13
225 0.14
226 0.15
227 0.2
228 0.21
229 0.23
230 0.27
231 0.28
232 0.29
233 0.33
234 0.38
235 0.32
236 0.33
237 0.29
238 0.24
239 0.21
240 0.19
241 0.14
242 0.08
243 0.07
244 0.04
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.04
251 0.05
252 0.05
253 0.05
254 0.05
255 0.07
256 0.08
257 0.08
258 0.08
259 0.09
260 0.09
261 0.12
262 0.14
263 0.13
264 0.15
265 0.14
266 0.13
267 0.12
268 0.12
269 0.12
270 0.1
271 0.1
272 0.1
273 0.12
274 0.13
275 0.13
276 0.12
277 0.11
278 0.11
279 0.1
280 0.09
281 0.07
282 0.06
283 0.09
284 0.09
285 0.08
286 0.08
287 0.07
288 0.07
289 0.07
290 0.08
291 0.05
292 0.05
293 0.05
294 0.05
295 0.05
296 0.04
297 0.04
298 0.03
299 0.03
300 0.05
301 0.05
302 0.05
303 0.05
304 0.06
305 0.06
306 0.07
307 0.12
308 0.11
309 0.11
310 0.11
311 0.11
312 0.11
313 0.11
314 0.11
315 0.06
316 0.05
317 0.05
318 0.08
319 0.08
320 0.08
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.04
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.04
333 0.04
334 0.05
335 0.04
336 0.05
337 0.05
338 0.05
339 0.07
340 0.09
341 0.09
342 0.1
343 0.11
344 0.12
345 0.11
346 0.11
347 0.1
348 0.08
349 0.08
350 0.06
351 0.05
352 0.04
353 0.04
354 0.04
355 0.04
356 0.05
357 0.06
358 0.07
359 0.08
360 0.1
361 0.12
362 0.13
363 0.2
364 0.25
365 0.31
366 0.4
367 0.46
368 0.48
369 0.54
370 0.59
371 0.53
372 0.53
373 0.53
374 0.49
375 0.48
376 0.45
377 0.39
378 0.33
379 0.33
380 0.28
381 0.22
382 0.15
383 0.1
384 0.09
385 0.09
386 0.09
387 0.08
388 0.13
389 0.13
390 0.14
391 0.22
392 0.23
393 0.25
394 0.28
395 0.3
396 0.27
397 0.27
398 0.29
399 0.23
400 0.26
401 0.27
402 0.26
403 0.27
404 0.26
405 0.26
406 0.25
407 0.27
408 0.23
409 0.2
410 0.17
411 0.15
412 0.16
413 0.15
414 0.14
415 0.11
416 0.12
417 0.14
418 0.16
419 0.18
420 0.17
421 0.18