Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YRL2

Protein Details
Accession A0A4Q4YRL2   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-33GVTKKTRKFAQVKRVISRRDSRRKENAGKADAHydrophilic
NLS Segment(s)
PositionSequence
8-26RKFAQVKRVISRRDSRRKE
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04900  Fcf1  
Amino Acid Sequences MGVTKKTRKFAQVKRVISRRDSRRKENAGKADAVNAQKAKVTANNDIIREVPQMPSSLFFQFNENLKPPYSVLVDTNFLSHTVQRKLPLLESMMELEKLGPKYRIGTYADDCIVDRVMKHRIYIVATNDKDLCRRIRKIPGVPIMNVARGKYVIERLPGAPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.78
4 0.76
5 0.76
6 0.76
7 0.77
8 0.76
9 0.76
10 0.78
11 0.83
12 0.84
13 0.84
14 0.82
15 0.75
16 0.7
17 0.61
18 0.55
19 0.5
20 0.42
21 0.38
22 0.29
23 0.25
24 0.23
25 0.23
26 0.21
27 0.2
28 0.23
29 0.23
30 0.31
31 0.34
32 0.33
33 0.33
34 0.32
35 0.29
36 0.27
37 0.22
38 0.15
39 0.13
40 0.13
41 0.13
42 0.13
43 0.14
44 0.14
45 0.14
46 0.13
47 0.15
48 0.17
49 0.19
50 0.21
51 0.21
52 0.2
53 0.19
54 0.2
55 0.18
56 0.17
57 0.16
58 0.13
59 0.13
60 0.13
61 0.14
62 0.13
63 0.13
64 0.11
65 0.1
66 0.1
67 0.11
68 0.13
69 0.14
70 0.15
71 0.16
72 0.18
73 0.19
74 0.19
75 0.18
76 0.15
77 0.14
78 0.13
79 0.13
80 0.11
81 0.11
82 0.1
83 0.09
84 0.11
85 0.11
86 0.12
87 0.12
88 0.12
89 0.15
90 0.16
91 0.2
92 0.19
93 0.22
94 0.23
95 0.25
96 0.25
97 0.23
98 0.22
99 0.19
100 0.17
101 0.13
102 0.11
103 0.11
104 0.17
105 0.17
106 0.17
107 0.18
108 0.2
109 0.23
110 0.27
111 0.29
112 0.33
113 0.33
114 0.35
115 0.36
116 0.34
117 0.34
118 0.33
119 0.36
120 0.34
121 0.39
122 0.43
123 0.51
124 0.59
125 0.64
126 0.69
127 0.7
128 0.66
129 0.62
130 0.61
131 0.53
132 0.5
133 0.44
134 0.35
135 0.28
136 0.24
137 0.25
138 0.22
139 0.26
140 0.24
141 0.26
142 0.28