Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YDA7

Protein Details
Accession A0A4Q4YDA7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRASTRKANNRRLKANVFHydrophilic
92-121APSNNKRDGKGRIQKRKKKANKVVFALYKDHydrophilic
NLS Segment(s)
PositionSequence
96-129NKRDGKGRIQKRKKKANKVVFALYKDKKSSKRKR
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASTRKANNRRLKANVFGPVESARAERLSAKLLELASQPKPEVKEVKVVEDVEAAEVMMDEDAAAAENADDTAMDVDSNNTTAAKSAPSNNKRDGKGRIQKRKKKANKVVFALYKDKKSSKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.83
4 0.77
5 0.73
6 0.68
7 0.65
8 0.57
9 0.49
10 0.44
11 0.36
12 0.32
13 0.26
14 0.22
15 0.15
16 0.13
17 0.13
18 0.12
19 0.13
20 0.15
21 0.14
22 0.14
23 0.15
24 0.15
25 0.15
26 0.16
27 0.18
28 0.17
29 0.18
30 0.17
31 0.18
32 0.19
33 0.21
34 0.24
35 0.21
36 0.27
37 0.27
38 0.3
39 0.3
40 0.29
41 0.25
42 0.22
43 0.2
44 0.12
45 0.11
46 0.08
47 0.05
48 0.04
49 0.04
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.06
71 0.06
72 0.05
73 0.05
74 0.06
75 0.07
76 0.08
77 0.09
78 0.16
79 0.27
80 0.33
81 0.38
82 0.45
83 0.52
84 0.53
85 0.57
86 0.57
87 0.58
88 0.62
89 0.67
90 0.71
91 0.75
92 0.82
93 0.86
94 0.9
95 0.9
96 0.92
97 0.92
98 0.91
99 0.9
100 0.87
101 0.86
102 0.81
103 0.76
104 0.74
105 0.68
106 0.64
107 0.6
108 0.62
109 0.62