Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Y158

Protein Details
Accession A0A4Q4Y158   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-63GAAISEKKLKRKRDGAKADDAPRBasic
83-105NGEETPRKSKKRKATQNAASEGEHydrophilic
205-228MQNGASGKKKRKGKKTKYLGEVDDHydrophilic
NLS Segment(s)
PositionSequence
37-96SGKKGAAISEKKLKRKRDGAKADDAPRAFKRLMAYASGKKPRSGLDNGEETPRKSKKRKA
211-220GKKKRKGKKT
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHTRREKDPSTFDLPPSQFAKPLPVRQEQQKNASGKKGAAISEKKLKRKRDGAKADDAPRAFKRLMAYASGKKPRSGLDNGEETPRKSKKRKATQNAASEGEAKETHEVPKIRPGERMSDFAARVDAALPISGLVNRSVRDGKDPLGLKVWRTNKERKMHKLYDEWREEERRIKEKREEELELQAERELEEEEAGVSWKIEMQNGASGKKKRKGKKTKYLGEVDDAEDDPWEALKKKRGETRAGLHDVVQAPPELAIKPQKKMTVRGAAVEVDGIPKAAGSLRRREELQTIRDDVVASYRKIMSEKRPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.61
3 0.6
4 0.53
5 0.48
6 0.45
7 0.39
8 0.34
9 0.32
10 0.4
11 0.37
12 0.43
13 0.45
14 0.48
15 0.52
16 0.6
17 0.7
18 0.66
19 0.67
20 0.67
21 0.67
22 0.63
23 0.64
24 0.57
25 0.47
26 0.45
27 0.41
28 0.36
29 0.38
30 0.39
31 0.39
32 0.46
33 0.52
34 0.58
35 0.63
36 0.68
37 0.69
38 0.74
39 0.78
40 0.79
41 0.82
42 0.78
43 0.81
44 0.8
45 0.76
46 0.72
47 0.63
48 0.57
49 0.49
50 0.47
51 0.37
52 0.31
53 0.28
54 0.27
55 0.27
56 0.27
57 0.31
58 0.34
59 0.43
60 0.49
61 0.48
62 0.44
63 0.44
64 0.42
65 0.42
66 0.39
67 0.35
68 0.32
69 0.36
70 0.36
71 0.42
72 0.41
73 0.37
74 0.41
75 0.42
76 0.46
77 0.47
78 0.55
79 0.59
80 0.68
81 0.78
82 0.8
83 0.84
84 0.84
85 0.85
86 0.81
87 0.72
88 0.62
89 0.53
90 0.43
91 0.34
92 0.25
93 0.18
94 0.15
95 0.14
96 0.15
97 0.18
98 0.19
99 0.18
100 0.26
101 0.3
102 0.29
103 0.33
104 0.33
105 0.35
106 0.36
107 0.37
108 0.32
109 0.31
110 0.3
111 0.25
112 0.24
113 0.17
114 0.14
115 0.12
116 0.1
117 0.06
118 0.05
119 0.05
120 0.04
121 0.05
122 0.05
123 0.05
124 0.06
125 0.08
126 0.08
127 0.11
128 0.12
129 0.13
130 0.16
131 0.17
132 0.16
133 0.21
134 0.22
135 0.2
136 0.24
137 0.24
138 0.21
139 0.27
140 0.31
141 0.33
142 0.37
143 0.44
144 0.46
145 0.55
146 0.61
147 0.63
148 0.66
149 0.63
150 0.62
151 0.63
152 0.61
153 0.61
154 0.57
155 0.51
156 0.46
157 0.45
158 0.42
159 0.4
160 0.4
161 0.39
162 0.4
163 0.42
164 0.46
165 0.48
166 0.52
167 0.5
168 0.49
169 0.42
170 0.45
171 0.42
172 0.34
173 0.3
174 0.24
175 0.19
176 0.15
177 0.14
178 0.08
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.06
185 0.05
186 0.04
187 0.04
188 0.06
189 0.07
190 0.07
191 0.08
192 0.08
193 0.13
194 0.15
195 0.17
196 0.22
197 0.28
198 0.35
199 0.42
200 0.5
201 0.54
202 0.63
203 0.72
204 0.77
205 0.82
206 0.85
207 0.87
208 0.86
209 0.84
210 0.75
211 0.67
212 0.58
213 0.49
214 0.4
215 0.31
216 0.23
217 0.17
218 0.15
219 0.1
220 0.09
221 0.1
222 0.1
223 0.14
224 0.21
225 0.27
226 0.33
227 0.41
228 0.45
229 0.5
230 0.55
231 0.59
232 0.6
233 0.6
234 0.54
235 0.47
236 0.47
237 0.41
238 0.35
239 0.27
240 0.18
241 0.14
242 0.14
243 0.15
244 0.1
245 0.12
246 0.21
247 0.24
248 0.28
249 0.33
250 0.39
251 0.42
252 0.48
253 0.53
254 0.53
255 0.51
256 0.49
257 0.47
258 0.4
259 0.37
260 0.31
261 0.22
262 0.14
263 0.12
264 0.1
265 0.07
266 0.06
267 0.07
268 0.1
269 0.17
270 0.2
271 0.3
272 0.34
273 0.38
274 0.4
275 0.43
276 0.49
277 0.49
278 0.51
279 0.48
280 0.47
281 0.44
282 0.43
283 0.41
284 0.32
285 0.32
286 0.3
287 0.25
288 0.25
289 0.26
290 0.26
291 0.3
292 0.35
293 0.37