Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YFR6

Protein Details
Accession A0A4Q4YFR6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-80SEPAVSPKRRWTKNSMRSELHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, E.R. 5, golg 5, extr 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYWICYGTAQLEGNLQWQVPFGLFFFILATVASCIWFRPESPGGSSYEAANKRPSRPREDSEPAVSPKRRWTKNSMRSELS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.1
4 0.1
5 0.1
6 0.08
7 0.08
8 0.07
9 0.08
10 0.07
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.07
23 0.07
24 0.07
25 0.12
26 0.14
27 0.15
28 0.16
29 0.18
30 0.18
31 0.2
32 0.2
33 0.15
34 0.2
35 0.21
36 0.21
37 0.27
38 0.28
39 0.32
40 0.41
41 0.45
42 0.47
43 0.52
44 0.56
45 0.57
46 0.62
47 0.6
48 0.57
49 0.58
50 0.53
51 0.55
52 0.53
53 0.46
54 0.49
55 0.54
56 0.56
57 0.55
58 0.61
59 0.64
60 0.72
61 0.8