Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8PQ06

Protein Details
Accession J8PQ06    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-105LARAKSKQGSKILKRRKLKGRWFLSHHydrophilic
NLS Segment(s)
PositionSequence
72-100KRKRTFGFLARAKSKQGSKILKRRKLKGR
Subcellular Location(s) mito 20.5, cyto_mito 11.333, nucl 3.5, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MTLFAKLYQLHSRRMFSSVSPFSALSVLRPQTSMLLNSSPLKTVSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.32
4 0.38
5 0.33
6 0.3
7 0.29
8 0.27
9 0.25
10 0.26
11 0.24
12 0.16
13 0.19
14 0.19
15 0.17
16 0.18
17 0.17
18 0.18
19 0.19
20 0.18
21 0.14
22 0.13
23 0.15
24 0.17
25 0.17
26 0.15
27 0.14
28 0.14
29 0.13
30 0.14
31 0.15
32 0.18
33 0.18
34 0.17
35 0.17
36 0.16
37 0.16
38 0.13
39 0.13
40 0.1
41 0.16
42 0.18
43 0.21
44 0.24
45 0.28
46 0.34
47 0.36
48 0.43
49 0.48
50 0.55
51 0.59
52 0.59
53 0.64
54 0.62
55 0.63
56 0.63
57 0.59
58 0.61
59 0.57
60 0.62
61 0.54
62 0.58
63 0.59
64 0.57
65 0.6
66 0.56
67 0.6
68 0.57
69 0.58
70 0.53
71 0.52
72 0.5
73 0.46
74 0.5
75 0.52
76 0.57
77 0.66
78 0.74
79 0.78
80 0.83
81 0.85
82 0.86
83 0.87
84 0.87
85 0.87