Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4YKA6

Protein Details
Accession A0A4Q4YKA6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
46-70LLRLLPPRRRCPRARRVRALRITPTHydrophilic
NLS Segment(s)
PositionSequence
34-64PPRPPRPPRRRLLLRLLPPRRRCPRARRVRA
Subcellular Location(s) mito 11, nucl 9, extr 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MLPPPPPTTPPPQLLLLLPYRPPLLPLPPQLLPPPRPPRPPRRRLLLRLLPPRRRCPRARRVRALRITPTVPYRTWAACIRRSRAVPTGRITTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.3
4 0.26
5 0.24
6 0.22
7 0.21
8 0.19
9 0.21
10 0.19
11 0.21
12 0.23
13 0.26
14 0.29
15 0.28
16 0.3
17 0.32
18 0.36
19 0.34
20 0.38
21 0.44
22 0.45
23 0.53
24 0.59
25 0.66
26 0.71
27 0.77
28 0.72
29 0.74
30 0.76
31 0.73
32 0.76
33 0.72
34 0.7
35 0.72
36 0.75
37 0.73
38 0.7
39 0.74
40 0.72
41 0.71
42 0.7
43 0.7
44 0.72
45 0.75
46 0.8
47 0.81
48 0.83
49 0.86
50 0.86
51 0.82
52 0.76
53 0.69
54 0.61
55 0.54
56 0.49
57 0.43
58 0.35
59 0.31
60 0.29
61 0.25
62 0.27
63 0.31
64 0.32
65 0.37
66 0.43
67 0.46
68 0.5
69 0.52
70 0.53
71 0.54
72 0.55
73 0.53
74 0.52