Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Y018

Protein Details
Accession A0A4Q4Y018   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-140RGLLKNSPPERQRRPRTPPSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5cyto_nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037177  DLC_sf  
IPR019763  Dynein_light_1/2_CS  
IPR001372  Dynein_light_chain_typ-1/2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0030286  C:dynein complex  
GO:0005874  C:microtubule  
GO:0005643  C:nuclear pore  
GO:0007017  P:microtubule-based process  
Pfam View protein in Pfam  
PF01221  Dynein_light  
PROSITE View protein in PROSITE  
PS01239  DYNEIN_LIGHT_1  
CDD cd21452  DLC-like_DYNLL1_DYNLL2  
Amino Acid Sequences MAEQTSPTPAAGRDRLEAQIKAADMAEDMQQEAIDVAQEAMGKFTIEKDIAQHIKRTFDERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQPNGLRDHVPVIAAMGLVPRGLLKNSPPERQRRPRTPPSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.35
4 0.34
5 0.29
6 0.28
7 0.25
8 0.23
9 0.21
10 0.16
11 0.11
12 0.12
13 0.12
14 0.09
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.04
22 0.04
23 0.04
24 0.05
25 0.06
26 0.06
27 0.06
28 0.07
29 0.06
30 0.06
31 0.07
32 0.09
33 0.08
34 0.09
35 0.1
36 0.17
37 0.22
38 0.23
39 0.27
40 0.26
41 0.3
42 0.3
43 0.35
44 0.32
45 0.33
46 0.41
47 0.39
48 0.43
49 0.45
50 0.46
51 0.43
52 0.4
53 0.37
54 0.29
55 0.33
56 0.28
57 0.27
58 0.26
59 0.24
60 0.22
61 0.2
62 0.19
63 0.13
64 0.16
65 0.15
66 0.14
67 0.14
68 0.17
69 0.18
70 0.18
71 0.18
72 0.15
73 0.12
74 0.14
75 0.16
76 0.2
77 0.2
78 0.18
79 0.18
80 0.17
81 0.16
82 0.14
83 0.14
84 0.08
85 0.09
86 0.11
87 0.13
88 0.18
89 0.19
90 0.22
91 0.23
92 0.25
93 0.25
94 0.26
95 0.25
96 0.2
97 0.18
98 0.15
99 0.13
100 0.09
101 0.08
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.06
108 0.08
109 0.1
110 0.13
111 0.23
112 0.29
113 0.38
114 0.44
115 0.52
116 0.62
117 0.71
118 0.79
119 0.79
120 0.83