Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Y6X2

Protein Details
Accession A0A4Q4Y6X2   
Localization Confidence High
Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-31IPTSADPRSKRPAKKRALTPLSAHydrophilic
122-147RERRDGEKTRRNRERREKMKARKAAQBasic
NLS Segment(s)
PositionSequence
17-24SKRPAKKR
116-145ERAREERERRDGEKTRRNRERREKMKARKA
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSGEGPESIPTSADPRSKRPAKKRALTPLSAQSAHLEALFAKPDQEVRIPAAAGSSSSGRRELPPPPEIVTNVQGSSAGAGSGEFHVYKAARRREYERLRRMDDEVRREREQAEFERAREERERRDGEKTRRNRERREKMKARKAAQQQQQQQKKKEGGGGDGALTTTTTTTTNTANNNDTASTTTAAPGAGTTSLSGGAPSNGEGGRDGPGGAGAGAGGVKGPRIDATRDNDDGGVNSRDGNGDGVAPQGVPDEGAAEEMQGIIIAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.43
4 0.52
5 0.61
6 0.68
7 0.74
8 0.77
9 0.83
10 0.86
11 0.87
12 0.85
13 0.79
14 0.74
15 0.72
16 0.68
17 0.59
18 0.5
19 0.4
20 0.34
21 0.3
22 0.24
23 0.16
24 0.1
25 0.12
26 0.13
27 0.11
28 0.11
29 0.11
30 0.13
31 0.15
32 0.17
33 0.17
34 0.18
35 0.2
36 0.19
37 0.18
38 0.17
39 0.14
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.15
46 0.15
47 0.18
48 0.21
49 0.26
50 0.29
51 0.3
52 0.31
53 0.31
54 0.32
55 0.31
56 0.31
57 0.28
58 0.24
59 0.21
60 0.19
61 0.17
62 0.14
63 0.13
64 0.1
65 0.06
66 0.04
67 0.04
68 0.05
69 0.06
70 0.07
71 0.06
72 0.06
73 0.09
74 0.09
75 0.13
76 0.21
77 0.28
78 0.31
79 0.35
80 0.4
81 0.49
82 0.59
83 0.66
84 0.67
85 0.65
86 0.65
87 0.64
88 0.62
89 0.6
90 0.55
91 0.54
92 0.52
93 0.52
94 0.49
95 0.48
96 0.45
97 0.4
98 0.38
99 0.31
100 0.32
101 0.28
102 0.27
103 0.32
104 0.31
105 0.32
106 0.34
107 0.34
108 0.3
109 0.37
110 0.41
111 0.37
112 0.46
113 0.51
114 0.54
115 0.6
116 0.63
117 0.65
118 0.7
119 0.75
120 0.76
121 0.79
122 0.81
123 0.8
124 0.83
125 0.83
126 0.83
127 0.87
128 0.84
129 0.77
130 0.74
131 0.74
132 0.73
133 0.71
134 0.69
135 0.68
136 0.71
137 0.77
138 0.76
139 0.71
140 0.68
141 0.63
142 0.56
143 0.52
144 0.43
145 0.35
146 0.3
147 0.26
148 0.2
149 0.17
150 0.15
151 0.11
152 0.09
153 0.07
154 0.04
155 0.05
156 0.05
157 0.06
158 0.07
159 0.09
160 0.12
161 0.14
162 0.17
163 0.18
164 0.18
165 0.18
166 0.17
167 0.16
168 0.15
169 0.14
170 0.12
171 0.11
172 0.11
173 0.1
174 0.1
175 0.09
176 0.07
177 0.07
178 0.06
179 0.06
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.09
190 0.08
191 0.09
192 0.09
193 0.09
194 0.11
195 0.11
196 0.1
197 0.08
198 0.08
199 0.08
200 0.07
201 0.06
202 0.04
203 0.04
204 0.03
205 0.03
206 0.04
207 0.03
208 0.04
209 0.04
210 0.05
211 0.08
212 0.1
213 0.14
214 0.2
215 0.27
216 0.33
217 0.34
218 0.35
219 0.33
220 0.31
221 0.28
222 0.27
223 0.22
224 0.16
225 0.15
226 0.15
227 0.15
228 0.15
229 0.15
230 0.11
231 0.1
232 0.1
233 0.1
234 0.1
235 0.09
236 0.08
237 0.08
238 0.08
239 0.07
240 0.07
241 0.07
242 0.07
243 0.09
244 0.08
245 0.07
246 0.07
247 0.07
248 0.07
249 0.06