Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4YEM6

Protein Details
Accession A0A4Q4YEM6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
387-408VVDFPTGPRRPPRSQRRPSRRLHydrophilic
NLS Segment(s)
PositionSequence
394-408PRRPPRSQRRPSRRL
Subcellular Location(s) extr 17, mito 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000907  LipOase  
IPR013819  LipOase_C  
IPR036226  LipOase_C_sf  
Gene Ontology GO:0050584  F:linoleate 11-lipoxygenase activity  
GO:0046872  F:metal ion binding  
GO:0043651  P:linoleic acid metabolic process  
GO:0034440  P:lipid oxidation  
Pfam View protein in Pfam  
PF00305  Lipoxygenase  
PROSITE View protein in PROSITE  
PS51393  LIPOXYGENASE_3  
Amino Acid Sequences MRSLATYAVFSTLSLTVHAAPRRTSAWARQLTGDTSPASIPQNDSDPERHAAGVGERRAGFGYGPSLISEAAPFPNGALGDIRTAYDYSVWEVDRNLIDAAVAKDVEVTTAAIQSNGGLKTFDDHVTVLYGEDLRPQIAGVSLDQPHKSGSLFVVDHRYQTELEKTTIQPQRYGAASSAYFYIHPESGDFLPLAIRTKAGSDLVYSPLDDPTDWLLAKMIFNVDDFFHAQMFHLVVTHDVSAAVHLAALRTLSEKHPAMITLERLMLQGCSSRAVGEELCFNQGGHWDQLFYVNNIGCRDYVTKNWPTRGAYQAGYLKNDFRARGLVDEKNEFNFKFFTFYQDALKIQEIYRDFFIAFVISYYASDDDVAADPEPQNWVAQAFAAKVVDFPTGPRRPPRSQRRPSRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.22
5 0.25
6 0.26
7 0.25
8 0.29
9 0.3
10 0.34
11 0.36
12 0.38
13 0.44
14 0.48
15 0.49
16 0.49
17 0.5
18 0.46
19 0.44
20 0.38
21 0.28
22 0.24
23 0.22
24 0.21
25 0.21
26 0.2
27 0.2
28 0.19
29 0.23
30 0.24
31 0.27
32 0.27
33 0.28
34 0.3
35 0.28
36 0.26
37 0.22
38 0.22
39 0.24
40 0.29
41 0.26
42 0.29
43 0.27
44 0.28
45 0.29
46 0.28
47 0.22
48 0.16
49 0.16
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.12
56 0.11
57 0.1
58 0.09
59 0.1
60 0.09
61 0.08
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.11
72 0.1
73 0.1
74 0.1
75 0.11
76 0.14
77 0.14
78 0.13
79 0.14
80 0.17
81 0.15
82 0.16
83 0.14
84 0.11
85 0.1
86 0.12
87 0.13
88 0.11
89 0.1
90 0.09
91 0.09
92 0.09
93 0.1
94 0.08
95 0.07
96 0.06
97 0.09
98 0.09
99 0.08
100 0.08
101 0.08
102 0.12
103 0.12
104 0.12
105 0.09
106 0.09
107 0.12
108 0.14
109 0.14
110 0.11
111 0.11
112 0.11
113 0.12
114 0.12
115 0.1
116 0.08
117 0.08
118 0.07
119 0.09
120 0.1
121 0.09
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.07
128 0.1
129 0.13
130 0.16
131 0.16
132 0.16
133 0.16
134 0.16
135 0.15
136 0.12
137 0.1
138 0.12
139 0.12
140 0.13
141 0.2
142 0.2
143 0.2
144 0.2
145 0.21
146 0.17
147 0.18
148 0.22
149 0.16
150 0.18
151 0.2
152 0.2
153 0.27
154 0.32
155 0.3
156 0.27
157 0.26
158 0.27
159 0.25
160 0.25
161 0.16
162 0.14
163 0.14
164 0.13
165 0.12
166 0.1
167 0.1
168 0.09
169 0.11
170 0.09
171 0.09
172 0.08
173 0.1
174 0.09
175 0.1
176 0.09
177 0.07
178 0.08
179 0.08
180 0.1
181 0.07
182 0.08
183 0.07
184 0.08
185 0.09
186 0.09
187 0.08
188 0.08
189 0.09
190 0.11
191 0.11
192 0.11
193 0.1
194 0.1
195 0.1
196 0.09
197 0.08
198 0.08
199 0.09
200 0.09
201 0.08
202 0.09
203 0.09
204 0.09
205 0.09
206 0.07
207 0.06
208 0.06
209 0.07
210 0.06
211 0.08
212 0.08
213 0.08
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.06
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.06
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.07
239 0.08
240 0.13
241 0.13
242 0.14
243 0.14
244 0.15
245 0.16
246 0.17
247 0.17
248 0.13
249 0.14
250 0.13
251 0.13
252 0.13
253 0.1
254 0.09
255 0.1
256 0.09
257 0.1
258 0.09
259 0.09
260 0.1
261 0.11
262 0.11
263 0.1
264 0.13
265 0.12
266 0.13
267 0.13
268 0.13
269 0.11
270 0.14
271 0.16
272 0.14
273 0.14
274 0.13
275 0.13
276 0.18
277 0.19
278 0.16
279 0.18
280 0.17
281 0.19
282 0.2
283 0.2
284 0.15
285 0.16
286 0.2
287 0.18
288 0.22
289 0.26
290 0.34
291 0.38
292 0.41
293 0.43
294 0.43
295 0.45
296 0.45
297 0.42
298 0.34
299 0.35
300 0.38
301 0.37
302 0.37
303 0.34
304 0.3
305 0.33
306 0.35
307 0.3
308 0.25
309 0.26
310 0.24
311 0.28
312 0.31
313 0.3
314 0.3
315 0.34
316 0.34
317 0.35
318 0.37
319 0.32
320 0.28
321 0.26
322 0.22
323 0.23
324 0.22
325 0.25
326 0.25
327 0.26
328 0.29
329 0.3
330 0.3
331 0.27
332 0.3
333 0.25
334 0.22
335 0.27
336 0.24
337 0.24
338 0.24
339 0.23
340 0.21
341 0.19
342 0.19
343 0.13
344 0.11
345 0.09
346 0.08
347 0.07
348 0.07
349 0.09
350 0.09
351 0.09
352 0.09
353 0.08
354 0.1
355 0.1
356 0.12
357 0.11
358 0.12
359 0.12
360 0.13
361 0.16
362 0.14
363 0.14
364 0.13
365 0.13
366 0.11
367 0.12
368 0.13
369 0.11
370 0.13
371 0.13
372 0.13
373 0.13
374 0.14
375 0.15
376 0.13
377 0.16
378 0.24
379 0.3
380 0.35
381 0.44
382 0.5
383 0.58
384 0.69
385 0.77
386 0.78
387 0.83
388 0.89