Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YIS3

Protein Details
Accession A0A4Q4YIS3   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
126-145LDKRLGKIRTTQKHEPRNGTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, cysk 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001466  Beta-lactam-related  
IPR012338  Beta-lactam/transpept-like  
Pfam View protein in Pfam  
PF00144  Beta-lactamase  
Amino Acid Sequences MTSLDELLESALSNGMAPGIVVIAKDKDIDYAKAFSRQGGTSYNLDTAMVVSSMTKFPTSVAALQLVDRGLVTLDEDLSRLLPTLAEKGVLTSVADDGTLTTRRRQKPITLRSLVAHSSGAGYPFLDKRLGKIRTTQKHEPRNGTVEETFGVPLLFEPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.04
9 0.06
10 0.07
11 0.08
12 0.09
13 0.09
14 0.13
15 0.15
16 0.17
17 0.18
18 0.21
19 0.22
20 0.27
21 0.27
22 0.24
23 0.25
24 0.23
25 0.23
26 0.22
27 0.24
28 0.2
29 0.21
30 0.21
31 0.18
32 0.17
33 0.15
34 0.12
35 0.09
36 0.07
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.07
43 0.07
44 0.07
45 0.1
46 0.11
47 0.11
48 0.12
49 0.12
50 0.12
51 0.12
52 0.13
53 0.1
54 0.08
55 0.07
56 0.06
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.07
86 0.11
87 0.11
88 0.17
89 0.26
90 0.3
91 0.35
92 0.38
93 0.45
94 0.51
95 0.6
96 0.64
97 0.59
98 0.56
99 0.53
100 0.53
101 0.45
102 0.35
103 0.26
104 0.16
105 0.15
106 0.14
107 0.13
108 0.1
109 0.09
110 0.11
111 0.12
112 0.13
113 0.16
114 0.15
115 0.19
116 0.28
117 0.32
118 0.3
119 0.39
120 0.48
121 0.53
122 0.62
123 0.68
124 0.68
125 0.75
126 0.82
127 0.8
128 0.75
129 0.71
130 0.65
131 0.6
132 0.51
133 0.42
134 0.35
135 0.29
136 0.23
137 0.17
138 0.15
139 0.09