Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XLZ9

Protein Details
Accession A0A4Q4XLZ9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LTAALEKAKPKKRKEVQPEPNKDFVKHydrophilic
NLS Segment(s)
PositionSequence
13-20KAKPKKRK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009014  Transketo_C/PFOR_II  
IPR005593  Xul5P/Fru6P_PKetolase  
IPR018969  Xul5P/Fru6P_PKetolase_C  
Gene Ontology GO:0016832  F:aldehyde-lyase activity  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF09363  XFP_C  
Amino Acid Sequences MLNNSQLTAALEKAKPKKRKEVQPEPNKDFVKIISVREQDEPSESEEDSDDDPECIIVRGGYTEKGNIDTPLELAIRNQTDRFSLAMDAIDRMPHLHNAGASAREKLRVQQQAASNEAYENGSDPEYLTNWKWPERKKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.57
4 0.66
5 0.7
6 0.79
7 0.82
8 0.84
9 0.85
10 0.88
11 0.91
12 0.86
13 0.85
14 0.75
15 0.66
16 0.55
17 0.45
18 0.41
19 0.33
20 0.3
21 0.3
22 0.31
23 0.32
24 0.34
25 0.34
26 0.27
27 0.27
28 0.25
29 0.2
30 0.19
31 0.17
32 0.14
33 0.14
34 0.15
35 0.13
36 0.13
37 0.1
38 0.08
39 0.08
40 0.08
41 0.08
42 0.06
43 0.06
44 0.04
45 0.04
46 0.05
47 0.06
48 0.08
49 0.08
50 0.08
51 0.09
52 0.11
53 0.11
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.09
63 0.1
64 0.11
65 0.11
66 0.1
67 0.11
68 0.12
69 0.12
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.08
80 0.09
81 0.09
82 0.1
83 0.1
84 0.1
85 0.12
86 0.13
87 0.15
88 0.15
89 0.17
90 0.17
91 0.19
92 0.2
93 0.21
94 0.28
95 0.32
96 0.33
97 0.36
98 0.42
99 0.42
100 0.45
101 0.42
102 0.34
103 0.27
104 0.26
105 0.21
106 0.15
107 0.12
108 0.11
109 0.1
110 0.1
111 0.1
112 0.11
113 0.12
114 0.16
115 0.16
116 0.22
117 0.25
118 0.33
119 0.4
120 0.45