Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YKW6

Protein Details
Accession A0A4Q4YKW6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-35IRTHHITSRKKLQRVKRAARQLGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MSRSANLFITLIRTHHITSRKKLQRVKRAARQLGVPFVLVRSGGSPGIMYAEGPDESGVTNWVNAVKSLRYKDFQCAQKPIAHPVNVDEQTKYASFNEVASVTEFSGVMQRKGLSAWWEAGMGYKAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.32
4 0.34
5 0.4
6 0.51
7 0.58
8 0.64
9 0.71
10 0.75
11 0.77
12 0.82
13 0.84
14 0.83
15 0.84
16 0.81
17 0.75
18 0.71
19 0.63
20 0.57
21 0.47
22 0.38
23 0.27
24 0.22
25 0.2
26 0.14
27 0.11
28 0.07
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.07
35 0.07
36 0.06
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.12
55 0.14
56 0.17
57 0.18
58 0.19
59 0.25
60 0.31
61 0.36
62 0.38
63 0.39
64 0.39
65 0.42
66 0.42
67 0.43
68 0.41
69 0.35
70 0.31
71 0.28
72 0.35
73 0.32
74 0.32
75 0.25
76 0.2
77 0.22
78 0.22
79 0.21
80 0.13
81 0.13
82 0.13
83 0.13
84 0.14
85 0.12
86 0.13
87 0.13
88 0.13
89 0.11
90 0.11
91 0.1
92 0.09
93 0.15
94 0.16
95 0.15
96 0.16
97 0.16
98 0.16
99 0.17
100 0.19
101 0.16
102 0.17
103 0.18
104 0.17
105 0.17
106 0.17
107 0.19
108 0.19