Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XAX9

Protein Details
Accession A0A4Q4XAX9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-107REWQERQWREQRWREREWRRHHRHDDDDBasic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 9, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024446  PXPV  
Pfam View protein in Pfam  
PF12778  PXPV  
Amino Acid Sequences MHKNFALYVLAAAAALSSQAALARVNVDIGIGVPVAPVYVEPAPVYAPPPPPAYYAPAPVYVAPQPVIVAPGYYDDGRGREWQERQWREQRWREREWRRHHRHDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.07
12 0.07
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.05
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.09
33 0.09
34 0.11
35 0.13
36 0.15
37 0.16
38 0.17
39 0.18
40 0.21
41 0.19
42 0.21
43 0.2
44 0.18
45 0.18
46 0.16
47 0.17
48 0.14
49 0.13
50 0.11
51 0.09
52 0.09
53 0.08
54 0.09
55 0.07
56 0.06
57 0.05
58 0.06
59 0.08
60 0.08
61 0.09
62 0.1
63 0.11
64 0.13
65 0.16
66 0.17
67 0.22
68 0.24
69 0.31
70 0.41
71 0.45
72 0.51
73 0.57
74 0.63
75 0.67
76 0.74
77 0.77
78 0.74
79 0.78
80 0.81
81 0.83
82 0.85
83 0.86
84 0.87
85 0.87
86 0.9
87 0.91