Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L981

Protein Details
Accession E2L981    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-82HADTETPKKKGKRRGRASIHTANMRNHydrophilic
NLS Segment(s)
PositionSequence
63-72PKKKGKRRGR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR004166  MHCK_EF2_kinase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
KEGG mpr:MPER_02552  -  
Pfam View protein in Pfam  
PF02816  Alpha_kinase  
PROSITE View protein in PROSITE  
PS51158  ALPHA_KINASE  
Amino Acid Sequences SPTVVNGSVHRHLFDAMVHTDDGTMGPGDHGLAGIDAFIDGHTCNRICNSLLLSKYHADTETPKKKGKRRGRASIHTANMRNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.15
4 0.15
5 0.15
6 0.14
7 0.13
8 0.12
9 0.11
10 0.08
11 0.07
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.02
26 0.03
27 0.03
28 0.04
29 0.05
30 0.06
31 0.06
32 0.07
33 0.08
34 0.09
35 0.1
36 0.12
37 0.15
38 0.17
39 0.18
40 0.2
41 0.2
42 0.2
43 0.2
44 0.17
45 0.14
46 0.19
47 0.29
48 0.35
49 0.39
50 0.45
51 0.52
52 0.6
53 0.69
54 0.74
55 0.75
56 0.75
57 0.82
58 0.85
59 0.87
60 0.88
61 0.86
62 0.83
63 0.8