Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4Y328

Protein Details
Accession A0A4Q4Y328    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
109-128NEPNEKKREKVLREGNKPLDBasic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MASQLFKRVSLRGAVLAPRILTPAASANSVRFYREGNTPQATSNVKGNPRSGSPQEQSANSAAGLRHKAGNTTGDSGSLAKPVSNPDAAGIGGQEEPQPSQENMKRDPNEPNEKKREKVLREGNKPLDPADK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.23
5 0.2
6 0.19
7 0.16
8 0.13
9 0.12
10 0.14
11 0.13
12 0.15
13 0.15
14 0.15
15 0.2
16 0.2
17 0.2
18 0.17
19 0.17
20 0.18
21 0.24
22 0.27
23 0.27
24 0.3
25 0.29
26 0.3
27 0.33
28 0.32
29 0.26
30 0.28
31 0.27
32 0.28
33 0.29
34 0.3
35 0.27
36 0.28
37 0.32
38 0.3
39 0.32
40 0.29
41 0.33
42 0.33
43 0.31
44 0.31
45 0.27
46 0.23
47 0.17
48 0.17
49 0.11
50 0.12
51 0.13
52 0.11
53 0.13
54 0.12
55 0.13
56 0.12
57 0.15
58 0.14
59 0.16
60 0.15
61 0.13
62 0.14
63 0.14
64 0.13
65 0.12
66 0.1
67 0.07
68 0.08
69 0.1
70 0.12
71 0.11
72 0.11
73 0.1
74 0.11
75 0.11
76 0.1
77 0.08
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.09
85 0.12
86 0.12
87 0.2
88 0.24
89 0.28
90 0.33
91 0.42
92 0.43
93 0.43
94 0.51
95 0.52
96 0.59
97 0.62
98 0.67
99 0.68
100 0.71
101 0.7
102 0.71
103 0.72
104 0.66
105 0.69
106 0.7
107 0.7
108 0.73
109 0.8
110 0.78
111 0.72
112 0.68