Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XSC3

Protein Details
Accession A0A4V1XSC3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-85DAWFRRRPPHGWRRWWMRLFDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, plas 7, mito 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPWRHSLLIGSVVWLYLLWDRVEQNVESARQHPLRGGALPNAVYVLGLAPQVAAIFGIWAVLAVDAWFRRRPPHGWRRWWMRLFDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.08
4 0.1
5 0.09
6 0.11
7 0.11
8 0.13
9 0.16
10 0.14
11 0.15
12 0.16
13 0.17
14 0.17
15 0.18
16 0.22
17 0.21
18 0.22
19 0.2
20 0.19
21 0.19
22 0.19
23 0.19
24 0.15
25 0.15
26 0.15
27 0.14
28 0.11
29 0.1
30 0.08
31 0.06
32 0.05
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.03
45 0.02
46 0.02
47 0.03
48 0.03
49 0.03
50 0.03
51 0.05
52 0.06
53 0.1
54 0.12
55 0.13
56 0.18
57 0.23
58 0.29
59 0.38
60 0.48
61 0.55
62 0.63
63 0.72
64 0.77
65 0.83
66 0.83