Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Y8G6

Protein Details
Accession A0A4Q4Y8G6    Localization Confidence High Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
128-175GESVTRPHKRLKNSKLLRRDKPLGLRTAIRRRKLIRRRQDFRIRQLSSHydrophilic
787-806GGHNPNWRSRNRQGNRRRRDBasic
NLS Segment(s)
PositionSequence
133-168RPHKRLKNSKLLRRDKPLGLRTAIRRRKLIRRRQDF
181-188RKVIRARK
202-208IKPPKGA
731-806PRDQPRGPRGPRGPSGPRGRRGPGGPPRGPAGSTGSVEPFPRGPRDTGGPPRGPSGGGHNPNWRSRNRQGNRRRRD
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
IPR006671  Cyclin_N  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
CDD cd20547  CYCLIN_ScCTK2-like_rpt1  
Amino Acid Sequences MASQGAHIDYPDVSPDVLDAAMALMTLRYGVIQSGPGADCQPISERVPSRAGQPSQDRDHLPAYTGSTQPVGQQDLQHSFVTGHTLATTPPCSFPVIHTESHTIWLPGEAIPGREAEKKSETSNIVNGESVTRPHKRLKNSKLLRRDKPLGLRTAIRRRKLIRRRQDFRIRQLSSQYIQRRKVIRARKLNSLLNSIKFLKSIKPPKGAKCVGRGRGKVAALSSFPEDPPREEDTASVAPATSGGLRNFHRDLLAALPFSFGLGQPYPRLGAGLDLDSLRASLRFGVAFPEGPPQLSEDQPVQLSQHQTAQDDSSDRSRENQGASLRQPVEEDLSDSSTEESGGVSLRRPASEDSGDSSAEENQVVSLRGGGYSPKMPPDVGPHPGNIRTTRQYDFEHSIRRKLGKPGVDIVREEEYRLKGIQLILALKGEVRLPIKTYVAATVFYHRFRLKHLGTQHHWRDGAIACLFLACKAEDTQKKSREILCANYNMSHSDKKTPDDKPQRLIIGLERLVIESIHFDFRVRHPQDILARLVKKVLPGNEDGRNFFPAAFQVLWDMHMTYAPIKQTSYTMALAVSEVTALLTGMHVEKFQSLDPKAHYTDRGSVTETILDILDLYENHHDMTQFGKQFPLETFIDLKILVNKELEEKHLPRYKFQCAECEKNPEPTSDSDDPDIAPSGTGQGEGTVRYVFDTTQAAEELNEVRKYVEDDYEFYEVEEEEEIRDSPPPAPRDQPRGPRGPRGPSGPRGRRGPGGPPRGPAGSTGSVEPFPRGPRDTGGPPRGPSGGGHNPNWRSRNRQGNRRRRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.08
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.07
19 0.08
20 0.09
21 0.13
22 0.14
23 0.15
24 0.16
25 0.15
26 0.15
27 0.15
28 0.18
29 0.18
30 0.2
31 0.27
32 0.29
33 0.32
34 0.37
35 0.36
36 0.38
37 0.43
38 0.43
39 0.43
40 0.48
41 0.53
42 0.54
43 0.59
44 0.55
45 0.5
46 0.51
47 0.44
48 0.37
49 0.32
50 0.31
51 0.29
52 0.28
53 0.26
54 0.24
55 0.23
56 0.25
57 0.26
58 0.25
59 0.22
60 0.25
61 0.29
62 0.32
63 0.35
64 0.31
65 0.28
66 0.25
67 0.23
68 0.25
69 0.19
70 0.15
71 0.13
72 0.13
73 0.13
74 0.17
75 0.19
76 0.15
77 0.17
78 0.18
79 0.19
80 0.19
81 0.2
82 0.25
83 0.27
84 0.27
85 0.29
86 0.32
87 0.3
88 0.33
89 0.32
90 0.23
91 0.2
92 0.19
93 0.17
94 0.13
95 0.16
96 0.14
97 0.14
98 0.14
99 0.15
100 0.17
101 0.22
102 0.23
103 0.24
104 0.28
105 0.29
106 0.31
107 0.36
108 0.37
109 0.34
110 0.37
111 0.35
112 0.31
113 0.29
114 0.28
115 0.24
116 0.22
117 0.22
118 0.23
119 0.25
120 0.28
121 0.37
122 0.43
123 0.5
124 0.6
125 0.67
126 0.71
127 0.77
128 0.82
129 0.84
130 0.88
131 0.85
132 0.84
133 0.81
134 0.77
135 0.76
136 0.73
137 0.67
138 0.61
139 0.6
140 0.6
141 0.64
142 0.65
143 0.6
144 0.61
145 0.63
146 0.7
147 0.74
148 0.76
149 0.76
150 0.79
151 0.8
152 0.83
153 0.88
154 0.85
155 0.85
156 0.84
157 0.76
158 0.68
159 0.67
160 0.62
161 0.54
162 0.54
163 0.53
164 0.51
165 0.52
166 0.56
167 0.56
168 0.57
169 0.63
170 0.65
171 0.65
172 0.68
173 0.67
174 0.71
175 0.73
176 0.71
177 0.65
178 0.63
179 0.58
180 0.49
181 0.49
182 0.42
183 0.35
184 0.31
185 0.3
186 0.27
187 0.33
188 0.4
189 0.43
190 0.5
191 0.56
192 0.61
193 0.69
194 0.7
195 0.64
196 0.65
197 0.66
198 0.66
199 0.68
200 0.63
201 0.57
202 0.57
203 0.53
204 0.45
205 0.37
206 0.3
207 0.23
208 0.23
209 0.21
210 0.16
211 0.16
212 0.2
213 0.2
214 0.19
215 0.24
216 0.26
217 0.25
218 0.24
219 0.24
220 0.24
221 0.24
222 0.22
223 0.17
224 0.13
225 0.11
226 0.11
227 0.11
228 0.07
229 0.09
230 0.1
231 0.14
232 0.15
233 0.21
234 0.21
235 0.21
236 0.2
237 0.17
238 0.18
239 0.17
240 0.18
241 0.13
242 0.12
243 0.12
244 0.11
245 0.11
246 0.1
247 0.07
248 0.09
249 0.09
250 0.1
251 0.11
252 0.12
253 0.12
254 0.12
255 0.12
256 0.08
257 0.09
258 0.09
259 0.09
260 0.09
261 0.08
262 0.09
263 0.08
264 0.08
265 0.07
266 0.06
267 0.05
268 0.05
269 0.06
270 0.06
271 0.06
272 0.09
273 0.1
274 0.1
275 0.1
276 0.14
277 0.14
278 0.14
279 0.14
280 0.14
281 0.15
282 0.15
283 0.16
284 0.12
285 0.13
286 0.14
287 0.14
288 0.13
289 0.13
290 0.15
291 0.14
292 0.17
293 0.17
294 0.18
295 0.18
296 0.18
297 0.16
298 0.16
299 0.16
300 0.17
301 0.17
302 0.16
303 0.18
304 0.2
305 0.21
306 0.21
307 0.24
308 0.22
309 0.25
310 0.26
311 0.3
312 0.28
313 0.26
314 0.25
315 0.21
316 0.2
317 0.16
318 0.16
319 0.1
320 0.11
321 0.11
322 0.11
323 0.11
324 0.08
325 0.08
326 0.07
327 0.06
328 0.05
329 0.05
330 0.06
331 0.06
332 0.09
333 0.1
334 0.1
335 0.12
336 0.13
337 0.16
338 0.17
339 0.17
340 0.16
341 0.17
342 0.17
343 0.16
344 0.15
345 0.12
346 0.11
347 0.1
348 0.07
349 0.06
350 0.07
351 0.07
352 0.06
353 0.06
354 0.05
355 0.06
356 0.06
357 0.06
358 0.07
359 0.08
360 0.09
361 0.1
362 0.11
363 0.11
364 0.12
365 0.17
366 0.19
367 0.22
368 0.22
369 0.22
370 0.23
371 0.25
372 0.27
373 0.22
374 0.23
375 0.22
376 0.24
377 0.25
378 0.26
379 0.26
380 0.28
381 0.3
382 0.3
383 0.35
384 0.33
385 0.35
386 0.35
387 0.37
388 0.35
389 0.36
390 0.38
391 0.33
392 0.34
393 0.36
394 0.38
395 0.36
396 0.33
397 0.3
398 0.28
399 0.24
400 0.23
401 0.2
402 0.16
403 0.16
404 0.16
405 0.13
406 0.11
407 0.11
408 0.12
409 0.1
410 0.1
411 0.09
412 0.09
413 0.09
414 0.07
415 0.08
416 0.07
417 0.08
418 0.08
419 0.08
420 0.1
421 0.12
422 0.12
423 0.12
424 0.12
425 0.12
426 0.12
427 0.12
428 0.11
429 0.15
430 0.17
431 0.17
432 0.2
433 0.19
434 0.19
435 0.21
436 0.29
437 0.25
438 0.29
439 0.35
440 0.4
441 0.42
442 0.52
443 0.51
444 0.47
445 0.46
446 0.4
447 0.36
448 0.28
449 0.29
450 0.19
451 0.15
452 0.11
453 0.11
454 0.11
455 0.09
456 0.09
457 0.05
458 0.06
459 0.07
460 0.15
461 0.19
462 0.26
463 0.34
464 0.39
465 0.42
466 0.44
467 0.46
468 0.45
469 0.43
470 0.42
471 0.38
472 0.36
473 0.34
474 0.32
475 0.3
476 0.25
477 0.26
478 0.24
479 0.21
480 0.25
481 0.26
482 0.28
483 0.34
484 0.35
485 0.43
486 0.5
487 0.53
488 0.5
489 0.52
490 0.5
491 0.44
492 0.41
493 0.33
494 0.28
495 0.25
496 0.21
497 0.17
498 0.16
499 0.16
500 0.14
501 0.12
502 0.07
503 0.08
504 0.09
505 0.09
506 0.09
507 0.11
508 0.15
509 0.25
510 0.26
511 0.26
512 0.25
513 0.3
514 0.35
515 0.36
516 0.36
517 0.32
518 0.31
519 0.29
520 0.31
521 0.26
522 0.25
523 0.25
524 0.25
525 0.21
526 0.24
527 0.28
528 0.32
529 0.33
530 0.32
531 0.3
532 0.29
533 0.26
534 0.23
535 0.19
536 0.13
537 0.15
538 0.12
539 0.11
540 0.11
541 0.11
542 0.12
543 0.11
544 0.11
545 0.08
546 0.08
547 0.09
548 0.08
549 0.11
550 0.11
551 0.11
552 0.11
553 0.12
554 0.13
555 0.15
556 0.17
557 0.15
558 0.14
559 0.13
560 0.13
561 0.12
562 0.11
563 0.08
564 0.05
565 0.04
566 0.03
567 0.03
568 0.03
569 0.03
570 0.03
571 0.04
572 0.05
573 0.05
574 0.06
575 0.06
576 0.07
577 0.08
578 0.1
579 0.16
580 0.16
581 0.2
582 0.23
583 0.27
584 0.29
585 0.3
586 0.31
587 0.28
588 0.34
589 0.34
590 0.33
591 0.31
592 0.29
593 0.28
594 0.26
595 0.23
596 0.17
597 0.12
598 0.11
599 0.08
600 0.07
601 0.07
602 0.06
603 0.08
604 0.09
605 0.1
606 0.1
607 0.11
608 0.11
609 0.1
610 0.14
611 0.18
612 0.19
613 0.19
614 0.21
615 0.2
616 0.22
617 0.22
618 0.23
619 0.18
620 0.17
621 0.19
622 0.17
623 0.18
624 0.17
625 0.17
626 0.17
627 0.18
628 0.17
629 0.15
630 0.16
631 0.2
632 0.21
633 0.25
634 0.27
635 0.27
636 0.35
637 0.42
638 0.42
639 0.44
640 0.49
641 0.53
642 0.53
643 0.53
644 0.53
645 0.54
646 0.61
647 0.58
648 0.62
649 0.55
650 0.57
651 0.57
652 0.49
653 0.45
654 0.39
655 0.43
656 0.38
657 0.38
658 0.3
659 0.3
660 0.28
661 0.26
662 0.25
663 0.17
664 0.13
665 0.1
666 0.11
667 0.1
668 0.1
669 0.08
670 0.09
671 0.09
672 0.1
673 0.11
674 0.09
675 0.09
676 0.1
677 0.11
678 0.09
679 0.11
680 0.12
681 0.12
682 0.13
683 0.13
684 0.13
685 0.12
686 0.14
687 0.15
688 0.19
689 0.18
690 0.17
691 0.17
692 0.18
693 0.21
694 0.21
695 0.23
696 0.2
697 0.22
698 0.26
699 0.28
700 0.27
701 0.24
702 0.22
703 0.17
704 0.16
705 0.15
706 0.11
707 0.09
708 0.11
709 0.11
710 0.11
711 0.13
712 0.14
713 0.17
714 0.24
715 0.26
716 0.29
717 0.37
718 0.43
719 0.51
720 0.58
721 0.64
722 0.65
723 0.72
724 0.73
725 0.75
726 0.75
727 0.74
728 0.7
729 0.69
730 0.68
731 0.67
732 0.74
733 0.72
734 0.73
735 0.71
736 0.7
737 0.67
738 0.63
739 0.64
740 0.63
741 0.64
742 0.6
743 0.56
744 0.56
745 0.52
746 0.48
747 0.4
748 0.37
749 0.31
750 0.29
751 0.28
752 0.27
753 0.27
754 0.28
755 0.28
756 0.25
757 0.25
758 0.29
759 0.3
760 0.3
761 0.32
762 0.38
763 0.45
764 0.51
765 0.55
766 0.55
767 0.53
768 0.54
769 0.51
770 0.45
771 0.38
772 0.36
773 0.38
774 0.39
775 0.42
776 0.48
777 0.53
778 0.6
779 0.65
780 0.62
781 0.6
782 0.63
783 0.69
784 0.7
785 0.75
786 0.78