Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YD37

Protein Details
Accession A0A4Q4YD37    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-78AMAKMKERRGRPARPCSRRRRACLLGAHydrophilic
NLS Segment(s)
PositionSequence
56-71MKERRGRPARPCSRRR
Subcellular Location(s) nucl 11, mito 8, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006710  Glyco_hydro_43  
IPR023296  Glyco_hydro_beta-prop_sf  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF04616  Glyco_hydro_43  
CDD cd18820  GH43_LbAraf43-like  
Amino Acid Sequences MPGRPRLGLYEAKCALIEWRTIISMTSRGLLSALVHGAESLLQPTANQCHGAMAKMKERRGRPARPCSRRRRACLLGAASAFTNPVRRPGGSDPFIAYSGDGYYYMMSTSWTNLQIARSKTIEGLKTAPKKVVYSTNEPRRCYNVWAPEVHYLDGNWYIYYTAGNASNLDGQNLHVLKGGPSAWDEYTYAGQLTNPWSIDRSVIRFNGWGNYLAYSCFHGVRYQSTCLQKLGDDNVSLTGPISVISQPTESWERSGMPVQEGPVALYYGGKTYIVYSANYCWTPDYCLATLEWDGRTNPLRPGAWKKPNDRVFSQANGHYGTGHNSFFQSPDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.27
4 0.25
5 0.17
6 0.18
7 0.18
8 0.18
9 0.18
10 0.17
11 0.18
12 0.17
13 0.17
14 0.16
15 0.15
16 0.15
17 0.15
18 0.13
19 0.12
20 0.12
21 0.1
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.07
28 0.07
29 0.07
30 0.07
31 0.1
32 0.14
33 0.15
34 0.16
35 0.14
36 0.19
37 0.19
38 0.22
39 0.25
40 0.25
41 0.32
42 0.37
43 0.43
44 0.45
45 0.48
46 0.56
47 0.59
48 0.65
49 0.67
50 0.73
51 0.78
52 0.81
53 0.89
54 0.89
55 0.91
56 0.9
57 0.87
58 0.85
59 0.81
60 0.76
61 0.74
62 0.66
63 0.6
64 0.51
65 0.44
66 0.35
67 0.29
68 0.23
69 0.15
70 0.16
71 0.12
72 0.17
73 0.19
74 0.19
75 0.24
76 0.29
77 0.37
78 0.35
79 0.36
80 0.32
81 0.32
82 0.32
83 0.27
84 0.2
85 0.13
86 0.11
87 0.1
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.06
95 0.06
96 0.07
97 0.09
98 0.1
99 0.11
100 0.12
101 0.15
102 0.19
103 0.21
104 0.23
105 0.21
106 0.21
107 0.23
108 0.26
109 0.25
110 0.21
111 0.23
112 0.27
113 0.32
114 0.33
115 0.33
116 0.3
117 0.29
118 0.3
119 0.35
120 0.32
121 0.35
122 0.43
123 0.51
124 0.55
125 0.56
126 0.56
127 0.52
128 0.49
129 0.46
130 0.42
131 0.4
132 0.37
133 0.37
134 0.38
135 0.38
136 0.37
137 0.32
138 0.26
139 0.18
140 0.16
141 0.16
142 0.14
143 0.08
144 0.07
145 0.07
146 0.06
147 0.07
148 0.06
149 0.05
150 0.06
151 0.06
152 0.06
153 0.07
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.13
160 0.13
161 0.13
162 0.1
163 0.11
164 0.1
165 0.12
166 0.12
167 0.08
168 0.09
169 0.1
170 0.09
171 0.1
172 0.1
173 0.09
174 0.1
175 0.1
176 0.09
177 0.07
178 0.07
179 0.07
180 0.1
181 0.1
182 0.1
183 0.1
184 0.11
185 0.11
186 0.14
187 0.14
188 0.15
189 0.17
190 0.17
191 0.18
192 0.18
193 0.18
194 0.18
195 0.18
196 0.16
197 0.13
198 0.14
199 0.13
200 0.12
201 0.12
202 0.11
203 0.11
204 0.1
205 0.1
206 0.11
207 0.12
208 0.17
209 0.2
210 0.21
211 0.26
212 0.3
213 0.31
214 0.3
215 0.29
216 0.25
217 0.24
218 0.25
219 0.21
220 0.17
221 0.16
222 0.17
223 0.16
224 0.15
225 0.12
226 0.08
227 0.06
228 0.06
229 0.07
230 0.06
231 0.07
232 0.08
233 0.09
234 0.08
235 0.13
236 0.16
237 0.16
238 0.17
239 0.17
240 0.18
241 0.19
242 0.24
243 0.21
244 0.2
245 0.21
246 0.2
247 0.21
248 0.2
249 0.18
250 0.15
251 0.14
252 0.11
253 0.1
254 0.09
255 0.08
256 0.09
257 0.08
258 0.07
259 0.08
260 0.12
261 0.13
262 0.14
263 0.14
264 0.17
265 0.21
266 0.21
267 0.21
268 0.19
269 0.18
270 0.22
271 0.23
272 0.26
273 0.22
274 0.22
275 0.22
276 0.23
277 0.24
278 0.22
279 0.2
280 0.17
281 0.17
282 0.21
283 0.24
284 0.24
285 0.26
286 0.29
287 0.3
288 0.34
289 0.44
290 0.5
291 0.56
292 0.62
293 0.66
294 0.7
295 0.76
296 0.76
297 0.7
298 0.66
299 0.61
300 0.58
301 0.57
302 0.5
303 0.45
304 0.41
305 0.38
306 0.33
307 0.29
308 0.28
309 0.25
310 0.23
311 0.21
312 0.2
313 0.21
314 0.21