Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8Q803

Protein Details
Accession J8Q803    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-43TRITLPRRPTKKIRLGKSRPAIYHHydrophilic
NLS Segment(s)
PositionSequence
26-36RRPTKKIRLGK
169-178KLASKKRDKK
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MLKFIFGKRFTSTGSYPGSTRITLPRRPTKKIRLGKSRPAIYHQFDVRMELSDGSVVIRRSQYPKSEIRLIQDQRNNPLWNPSRDDLVIVDANSGGSLDRFNKRYSSMFSVDTTPPSSGAGESEQPTESKKEAQLKKGEKKEEVSEGAFGMDDYLSLLDDGEQQIKSGKLASKKRDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.32
5 0.32
6 0.27
7 0.28
8 0.32
9 0.34
10 0.39
11 0.47
12 0.54
13 0.57
14 0.64
15 0.71
16 0.72
17 0.76
18 0.79
19 0.8
20 0.81
21 0.82
22 0.85
23 0.85
24 0.81
25 0.73
26 0.7
27 0.67
28 0.6
29 0.58
30 0.49
31 0.44
32 0.37
33 0.38
34 0.32
35 0.27
36 0.23
37 0.17
38 0.15
39 0.11
40 0.11
41 0.09
42 0.11
43 0.09
44 0.1
45 0.11
46 0.14
47 0.18
48 0.22
49 0.25
50 0.27
51 0.32
52 0.35
53 0.41
54 0.4
55 0.4
56 0.45
57 0.44
58 0.46
59 0.46
60 0.43
61 0.41
62 0.45
63 0.42
64 0.33
65 0.39
66 0.37
67 0.34
68 0.37
69 0.33
70 0.29
71 0.28
72 0.28
73 0.19
74 0.17
75 0.15
76 0.1
77 0.1
78 0.08
79 0.07
80 0.07
81 0.06
82 0.04
83 0.03
84 0.04
85 0.07
86 0.11
87 0.13
88 0.14
89 0.15
90 0.18
91 0.2
92 0.23
93 0.26
94 0.25
95 0.25
96 0.25
97 0.28
98 0.27
99 0.26
100 0.23
101 0.18
102 0.15
103 0.14
104 0.14
105 0.1
106 0.1
107 0.1
108 0.11
109 0.12
110 0.14
111 0.13
112 0.13
113 0.15
114 0.17
115 0.16
116 0.17
117 0.21
118 0.29
119 0.34
120 0.41
121 0.49
122 0.56
123 0.64
124 0.69
125 0.69
126 0.63
127 0.62
128 0.6
129 0.56
130 0.5
131 0.41
132 0.34
133 0.29
134 0.25
135 0.21
136 0.16
137 0.11
138 0.07
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.08
147 0.09
148 0.12
149 0.12
150 0.12
151 0.15
152 0.15
153 0.16
154 0.18
155 0.22
156 0.29
157 0.38
158 0.48