Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4X7N5

Protein Details
Accession A0A4Q4X7N5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
129-152YGDATPTKKRQRRTPALKKRAAVFHydrophilic
NLS Segment(s)
PositionSequence
82-107PKAKAGPKKGASSASAKGTGTGGRKR
136-148KKRQRRTPALKKR
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MADSNNTNESAGSKWTDAEKASMMVQIIDQLTSAGGKVRLGELNMPGRTTKSLTHMLGKIKDEAAAHKVEGGSGSGSVPATPKAKAGPKKGASSASAKGTGTGGRKRTKTVATATGSDAGDAGEKDGDYGDATPTKKRQRRTPALKKRAAVFKSESMAEDTVSEDGEDEKNTDAAALKAADAVNAAIAAANGAAAMDGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.21
4 0.2
5 0.21
6 0.19
7 0.18
8 0.18
9 0.18
10 0.16
11 0.14
12 0.13
13 0.13
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.14
28 0.16
29 0.18
30 0.24
31 0.25
32 0.25
33 0.23
34 0.23
35 0.24
36 0.23
37 0.2
38 0.19
39 0.24
40 0.25
41 0.3
42 0.32
43 0.35
44 0.37
45 0.37
46 0.34
47 0.28
48 0.28
49 0.23
50 0.22
51 0.2
52 0.17
53 0.15
54 0.15
55 0.14
56 0.12
57 0.12
58 0.1
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.08
67 0.09
68 0.09
69 0.1
70 0.13
71 0.2
72 0.27
73 0.31
74 0.38
75 0.41
76 0.43
77 0.44
78 0.43
79 0.38
80 0.35
81 0.32
82 0.25
83 0.23
84 0.2
85 0.18
86 0.17
87 0.17
88 0.17
89 0.19
90 0.23
91 0.26
92 0.27
93 0.29
94 0.32
95 0.32
96 0.31
97 0.31
98 0.32
99 0.3
100 0.3
101 0.29
102 0.29
103 0.27
104 0.23
105 0.19
106 0.12
107 0.1
108 0.09
109 0.08
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.07
118 0.1
119 0.11
120 0.15
121 0.22
122 0.32
123 0.37
124 0.43
125 0.51
126 0.58
127 0.68
128 0.76
129 0.81
130 0.82
131 0.87
132 0.88
133 0.81
134 0.76
135 0.75
136 0.65
137 0.58
138 0.51
139 0.45
140 0.42
141 0.39
142 0.34
143 0.27
144 0.27
145 0.22
146 0.17
147 0.14
148 0.12
149 0.11
150 0.1
151 0.07
152 0.08
153 0.09
154 0.1
155 0.09
156 0.1
157 0.1
158 0.1
159 0.11
160 0.1
161 0.09
162 0.11
163 0.1
164 0.09
165 0.12
166 0.12
167 0.11
168 0.1
169 0.1
170 0.08
171 0.07
172 0.07
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03