Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8Q1R4

Protein Details
Accession J8Q1R4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
68-92MESGWAGKRKHKKRTKVTLETISEEHydrophilic
NLS Segment(s)
PositionSequence
74-82GKRKHKKRT
Subcellular Location(s) mito 17, mito_nucl 14.333, nucl 9.5, cyto_nucl 5.666
Family & Domain DBs
Amino Acid Sequences MQSVSNCPMKVVSKNTINSANLTGWVAYPWKHINVVGSGRYVSSKPDKITRYDLLKAAYEAEKQDQLMESGWAGKRKHKKRTKVTLETISEENSSNESLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.47
4 0.44
5 0.4
6 0.37
7 0.3
8 0.24
9 0.22
10 0.18
11 0.13
12 0.13
13 0.12
14 0.09
15 0.13
16 0.14
17 0.15
18 0.15
19 0.15
20 0.16
21 0.19
22 0.21
23 0.18
24 0.17
25 0.15
26 0.15
27 0.16
28 0.14
29 0.14
30 0.17
31 0.19
32 0.2
33 0.26
34 0.28
35 0.3
36 0.35
37 0.36
38 0.34
39 0.33
40 0.33
41 0.28
42 0.27
43 0.24
44 0.21
45 0.18
46 0.14
47 0.14
48 0.14
49 0.13
50 0.13
51 0.13
52 0.11
53 0.11
54 0.11
55 0.1
56 0.08
57 0.12
58 0.14
59 0.19
60 0.2
61 0.28
62 0.38
63 0.46
64 0.57
65 0.62
66 0.7
67 0.76
68 0.86
69 0.89
70 0.88
71 0.88
72 0.86
73 0.81
74 0.74
75 0.65
76 0.56
77 0.46
78 0.37
79 0.3
80 0.22