Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L3K9

Protein Details
Accession E2L3K9   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-28PANGEKSKEKQEKKPTLNESHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, nucl 5, pero 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045338  DUF6535  
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_00173  -  
Pfam View protein in Pfam  
PF20153  DUF6535  
Amino Acid Sequences VTPEASTRPANGEKSKEKQEKKPTLNESWEKVLKEVARHDEDMVKGWRDDIDTLLVFAGLFSAVVTAFAIESYQWLDEDPADTTVALLTQLLLVQVNGSQPVSFEPTPFKPDASSIRINIFWFLSLIFSLTSALFGLLCKQWAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.66
4 0.68
5 0.71
6 0.77
7 0.79
8 0.78
9 0.81
10 0.77
11 0.75
12 0.77
13 0.72
14 0.66
15 0.62
16 0.6
17 0.5
18 0.44
19 0.41
20 0.34
21 0.32
22 0.33
23 0.32
24 0.32
25 0.32
26 0.33
27 0.32
28 0.3
29 0.31
30 0.28
31 0.23
32 0.19
33 0.18
34 0.18
35 0.16
36 0.16
37 0.12
38 0.12
39 0.1
40 0.11
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.03
47 0.03
48 0.02
49 0.03
50 0.02
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.02
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.03
81 0.04
82 0.04
83 0.05
84 0.05
85 0.06
86 0.05
87 0.06
88 0.07
89 0.13
90 0.13
91 0.13
92 0.18
93 0.2
94 0.25
95 0.25
96 0.25
97 0.19
98 0.23
99 0.28
100 0.3
101 0.31
102 0.28
103 0.31
104 0.32
105 0.32
106 0.29
107 0.24
108 0.18
109 0.14
110 0.12
111 0.1
112 0.09
113 0.09
114 0.07
115 0.07
116 0.08
117 0.07
118 0.08
119 0.07
120 0.07
121 0.06
122 0.07
123 0.1
124 0.1
125 0.13