Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YNQ7

Protein Details
Accession A0A4Q4YNQ7   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
397-420EQELEEKLRRQKEERKKRLNQGHRBasic
NLS Segment(s)
PositionSequence
209-220KKDREPAKPGAK
403-420KLRRQKEERKKRLNQGHR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
CDD cd22265  UDM1_RNF168  
Amino Acid Sequences MPIGDLLAEISGERPSPAAKTPPPSGIKRKADDLNGDSTKVAKARHTDVSTSKITRDLQGSAIGLCRSDSRPAAKPAYTGTSARRRSPQPQTSSPSTNGRSSKLTTTNGQHTSGSIVNGRPPPSSASSSAQRKPASDVASRPKLNPPSLSAPKMPPAKPSPTTPTASDPGKAPKRGSFAEIMARGAKAQQVMGKVGVIQHKAIEKPVVKKDREPAKPGAKTPTGKPYLGNARPTAMPSRDATRPAGQAANAQRNGVGKDGKQVGKQRPGSSGGDVQEKKVKKSAIATTGYTGTARPRPGASSSKSSSARNGKPQASSRAGGLLGPPKSSRRSREDDYDEDLDDFIEYDDEDEPDPRGGGYGYGYDSDASSDMEAGLSDIDEEERRATKEAIQEDKREQELEEKLRRQKEERKKRLNQGHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.13
4 0.18
5 0.25
6 0.29
7 0.35
8 0.39
9 0.47
10 0.53
11 0.58
12 0.63
13 0.66
14 0.69
15 0.66
16 0.69
17 0.66
18 0.65
19 0.65
20 0.58
21 0.57
22 0.5
23 0.47
24 0.4
25 0.35
26 0.33
27 0.29
28 0.27
29 0.22
30 0.26
31 0.3
32 0.39
33 0.4
34 0.42
35 0.43
36 0.47
37 0.48
38 0.45
39 0.41
40 0.37
41 0.36
42 0.35
43 0.34
44 0.3
45 0.26
46 0.27
47 0.26
48 0.21
49 0.23
50 0.19
51 0.16
52 0.15
53 0.16
54 0.15
55 0.19
56 0.22
57 0.25
58 0.31
59 0.37
60 0.42
61 0.39
62 0.39
63 0.37
64 0.39
65 0.36
66 0.32
67 0.34
68 0.39
69 0.42
70 0.45
71 0.49
72 0.49
73 0.55
74 0.63
75 0.65
76 0.63
77 0.67
78 0.7
79 0.69
80 0.68
81 0.64
82 0.61
83 0.55
84 0.54
85 0.48
86 0.44
87 0.41
88 0.39
89 0.41
90 0.39
91 0.39
92 0.37
93 0.4
94 0.46
95 0.45
96 0.43
97 0.37
98 0.31
99 0.31
100 0.28
101 0.24
102 0.18
103 0.16
104 0.2
105 0.23
106 0.25
107 0.22
108 0.22
109 0.24
110 0.25
111 0.28
112 0.26
113 0.27
114 0.33
115 0.4
116 0.43
117 0.45
118 0.42
119 0.4
120 0.41
121 0.42
122 0.38
123 0.34
124 0.37
125 0.39
126 0.47
127 0.47
128 0.44
129 0.46
130 0.47
131 0.46
132 0.42
133 0.38
134 0.38
135 0.43
136 0.44
137 0.4
138 0.36
139 0.4
140 0.45
141 0.41
142 0.38
143 0.38
144 0.41
145 0.4
146 0.43
147 0.43
148 0.4
149 0.42
150 0.38
151 0.37
152 0.35
153 0.34
154 0.3
155 0.26
156 0.3
157 0.34
158 0.34
159 0.32
160 0.31
161 0.35
162 0.35
163 0.35
164 0.28
165 0.24
166 0.27
167 0.25
168 0.23
169 0.19
170 0.18
171 0.15
172 0.14
173 0.13
174 0.08
175 0.08
176 0.1
177 0.1
178 0.11
179 0.11
180 0.1
181 0.1
182 0.12
183 0.14
184 0.13
185 0.12
186 0.13
187 0.14
188 0.15
189 0.15
190 0.17
191 0.17
192 0.22
193 0.3
194 0.36
195 0.35
196 0.38
197 0.45
198 0.5
199 0.51
200 0.51
201 0.5
202 0.51
203 0.53
204 0.52
205 0.5
206 0.45
207 0.43
208 0.41
209 0.43
210 0.37
211 0.35
212 0.33
213 0.33
214 0.37
215 0.39
216 0.39
217 0.3
218 0.29
219 0.29
220 0.3
221 0.28
222 0.2
223 0.18
224 0.17
225 0.2
226 0.2
227 0.22
228 0.24
229 0.23
230 0.23
231 0.22
232 0.22
233 0.18
234 0.22
235 0.25
236 0.3
237 0.27
238 0.26
239 0.25
240 0.26
241 0.26
242 0.23
243 0.2
244 0.13
245 0.18
246 0.24
247 0.25
248 0.28
249 0.35
250 0.4
251 0.47
252 0.52
253 0.48
254 0.45
255 0.47
256 0.44
257 0.39
258 0.37
259 0.3
260 0.34
261 0.32
262 0.31
263 0.33
264 0.33
265 0.32
266 0.32
267 0.31
268 0.25
269 0.31
270 0.35
271 0.35
272 0.37
273 0.36
274 0.33
275 0.33
276 0.31
277 0.25
278 0.2
279 0.17
280 0.19
281 0.19
282 0.18
283 0.18
284 0.2
285 0.25
286 0.31
287 0.31
288 0.34
289 0.35
290 0.41
291 0.43
292 0.42
293 0.45
294 0.48
295 0.49
296 0.51
297 0.56
298 0.52
299 0.56
300 0.6
301 0.6
302 0.55
303 0.5
304 0.41
305 0.36
306 0.32
307 0.26
308 0.24
309 0.23
310 0.19
311 0.2
312 0.21
313 0.23
314 0.3
315 0.36
316 0.4
317 0.41
318 0.48
319 0.51
320 0.6
321 0.63
322 0.6
323 0.6
324 0.56
325 0.49
326 0.41
327 0.36
328 0.26
329 0.19
330 0.15
331 0.09
332 0.07
333 0.05
334 0.06
335 0.07
336 0.08
337 0.09
338 0.09
339 0.11
340 0.11
341 0.11
342 0.1
343 0.1
344 0.09
345 0.09
346 0.09
347 0.1
348 0.1
349 0.11
350 0.12
351 0.11
352 0.11
353 0.12
354 0.11
355 0.1
356 0.09
357 0.08
358 0.08
359 0.08
360 0.07
361 0.06
362 0.06
363 0.05
364 0.05
365 0.05
366 0.07
367 0.08
368 0.09
369 0.12
370 0.15
371 0.17
372 0.19
373 0.2
374 0.23
375 0.3
376 0.36
377 0.43
378 0.46
379 0.49
380 0.52
381 0.57
382 0.54
383 0.48
384 0.41
385 0.39
386 0.43
387 0.47
388 0.51
389 0.53
390 0.59
391 0.65
392 0.7
393 0.71
394 0.73
395 0.75
396 0.77
397 0.8
398 0.83
399 0.85
400 0.91