Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8QAQ3

Protein Details
Accession J8QAQ3   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-106GRHHVYKKAKLMKQSKKKTSFTKFHydrophilic
NLS Segment(s)
PositionSequence
72-100KKKVSTSGWRDGRHHVYKKAKLMKQSKKK
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRASSHLNAKSIKRRGVFQKAVDAREQRISEKLKEDLLKQKLEDLKKKEEQGIEMEVDEKKPSDEAAKKKVSTSGWRDGRHHVYKKAKLMKQSKKKTSFTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.57
4 0.49
5 0.53
6 0.59
7 0.64
8 0.63
9 0.56
10 0.59
11 0.57
12 0.57
13 0.56
14 0.49
15 0.41
16 0.42
17 0.4
18 0.31
19 0.33
20 0.34
21 0.32
22 0.33
23 0.31
24 0.29
25 0.3
26 0.32
27 0.35
28 0.35
29 0.34
30 0.31
31 0.34
32 0.35
33 0.39
34 0.43
35 0.39
36 0.42
37 0.44
38 0.46
39 0.44
40 0.39
41 0.35
42 0.3
43 0.27
44 0.2
45 0.16
46 0.16
47 0.13
48 0.12
49 0.11
50 0.09
51 0.07
52 0.07
53 0.08
54 0.13
55 0.2
56 0.26
57 0.34
58 0.39
59 0.4
60 0.4
61 0.45
62 0.41
63 0.43
64 0.44
65 0.46
66 0.48
67 0.52
68 0.53
69 0.56
70 0.62
71 0.63
72 0.62
73 0.61
74 0.63
75 0.66
76 0.73
77 0.76
78 0.7
79 0.71
80 0.76
81 0.77
82 0.79
83 0.83
84 0.84
85 0.83
86 0.87