Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8LKX6

Protein Details
Accession J8LKX6   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-61VPPPSADPSKARKNRPKPSGNEGAIHydrophilic
NLS Segment(s)
PositionSequence
44-74PSKARKNRPKPSGNEGAIRDKSAGRRNNKSK
82-98TKKPNTRKATDRHSRTG
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MSNPFDLLGNDVEDADVVVLPPKEIVKSNTSSKKADVPPPSADPSKARKNRPKPSGNEGAIRDKSAGRRNNKSKDVTDTAATKKPNTRKATDRHSRTGKTDTKKKVSQGWGDDKKELSAEKEAQADAAAEIAEDAEGSEDAEKPKTTQLSLQDYLNQQANNQFNKVPEAKKVELDAEKIEAAEKEAYAPATKVKNVKSKQLKTKEYLDFDATFAESNTRKNFGDRSNFGDRNNNNNNNRNNFNNRRGGRTARKGNNSANTDNSANTVQKNRNIDVSNLPSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.05
5 0.09
6 0.09
7 0.09
8 0.1
9 0.11
10 0.13
11 0.16
12 0.2
13 0.22
14 0.28
15 0.37
16 0.45
17 0.48
18 0.49
19 0.48
20 0.53
21 0.54
22 0.57
23 0.54
24 0.5
25 0.51
26 0.53
27 0.56
28 0.49
29 0.45
30 0.43
31 0.45
32 0.51
33 0.53
34 0.59
35 0.65
36 0.73
37 0.81
38 0.85
39 0.86
40 0.81
41 0.82
42 0.81
43 0.74
44 0.7
45 0.63
46 0.62
47 0.54
48 0.48
49 0.41
50 0.34
51 0.37
52 0.39
53 0.43
54 0.42
55 0.52
56 0.6
57 0.68
58 0.72
59 0.71
60 0.65
61 0.65
62 0.62
63 0.54
64 0.48
65 0.43
66 0.4
67 0.4
68 0.38
69 0.33
70 0.36
71 0.41
72 0.48
73 0.48
74 0.49
75 0.53
76 0.59
77 0.66
78 0.69
79 0.68
80 0.67
81 0.69
82 0.67
83 0.63
84 0.64
85 0.61
86 0.6
87 0.63
88 0.62
89 0.62
90 0.63
91 0.63
92 0.62
93 0.6
94 0.58
95 0.56
96 0.58
97 0.59
98 0.57
99 0.56
100 0.48
101 0.41
102 0.36
103 0.29
104 0.21
105 0.17
106 0.17
107 0.17
108 0.18
109 0.17
110 0.16
111 0.15
112 0.13
113 0.09
114 0.07
115 0.05
116 0.03
117 0.03
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.03
125 0.03
126 0.05
127 0.05
128 0.07
129 0.07
130 0.07
131 0.1
132 0.11
133 0.11
134 0.13
135 0.18
136 0.24
137 0.25
138 0.25
139 0.26
140 0.26
141 0.27
142 0.27
143 0.21
144 0.15
145 0.19
146 0.24
147 0.21
148 0.22
149 0.21
150 0.19
151 0.24
152 0.27
153 0.23
154 0.23
155 0.29
156 0.29
157 0.29
158 0.29
159 0.29
160 0.27
161 0.27
162 0.23
163 0.17
164 0.16
165 0.15
166 0.14
167 0.1
168 0.1
169 0.09
170 0.08
171 0.08
172 0.08
173 0.09
174 0.09
175 0.09
176 0.12
177 0.14
178 0.17
179 0.21
180 0.26
181 0.35
182 0.36
183 0.46
184 0.52
185 0.59
186 0.66
187 0.72
188 0.71
189 0.66
190 0.73
191 0.7
192 0.64
193 0.58
194 0.51
195 0.42
196 0.37
197 0.34
198 0.25
199 0.18
200 0.14
201 0.16
202 0.13
203 0.17
204 0.19
205 0.21
206 0.22
207 0.24
208 0.29
209 0.32
210 0.4
211 0.39
212 0.43
213 0.5
214 0.52
215 0.51
216 0.54
217 0.5
218 0.5
219 0.57
220 0.59
221 0.57
222 0.63
223 0.69
224 0.66
225 0.68
226 0.65
227 0.66
228 0.65
229 0.66
230 0.68
231 0.62
232 0.63
233 0.64
234 0.66
235 0.66
236 0.68
237 0.71
238 0.7
239 0.76
240 0.75
241 0.77
242 0.77
243 0.73
244 0.66
245 0.59
246 0.54
247 0.47
248 0.42
249 0.37
250 0.32
251 0.28
252 0.28
253 0.32
254 0.34
255 0.39
256 0.45
257 0.44
258 0.47
259 0.47
260 0.47
261 0.48
262 0.48