Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YLB8

Protein Details
Accession A0A4Q4YLB8   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-38LLSTRRYRKILPKMNQENSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR018957  Znf_C3HC4_RING-type  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00097  zf-C3HC4  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MPPVLRSSRRHRHSDAVLLSTRRYRKILPKMNQENSLSEKLEPAQNGAVPEEVEPVGEVITECDYWPQVYCHLENRNANSEKAPRLELTCSICLSSVLKFPDPIMSNCDDRPVEELTVAPCGHTFGASCLRSWTDAKFVSKEIPGCPTCRFPLIHHACGHFIRVREFSSDELLGLARKVPIPAPQGGRVHPYCSGCRREMFEDSVLGTLQLIFDRSHQTREPLNPSHRDAVQAFLAHQFTTMAQHAYDSLRSQDTEENEWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.65
3 0.6
4 0.59
5 0.53
6 0.5
7 0.49
8 0.48
9 0.42
10 0.41
11 0.42
12 0.47
13 0.56
14 0.64
15 0.65
16 0.72
17 0.78
18 0.81
19 0.81
20 0.72
21 0.65
22 0.61
23 0.56
24 0.46
25 0.36
26 0.32
27 0.28
28 0.29
29 0.25
30 0.22
31 0.19
32 0.2
33 0.2
34 0.19
35 0.18
36 0.14
37 0.14
38 0.14
39 0.11
40 0.1
41 0.09
42 0.08
43 0.07
44 0.07
45 0.06
46 0.05
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.09
53 0.1
54 0.1
55 0.12
56 0.15
57 0.17
58 0.22
59 0.27
60 0.33
61 0.35
62 0.39
63 0.44
64 0.43
65 0.42
66 0.4
67 0.39
68 0.37
69 0.35
70 0.32
71 0.24
72 0.24
73 0.25
74 0.25
75 0.25
76 0.23
77 0.21
78 0.2
79 0.19
80 0.17
81 0.17
82 0.14
83 0.13
84 0.14
85 0.14
86 0.14
87 0.14
88 0.19
89 0.2
90 0.2
91 0.2
92 0.2
93 0.22
94 0.21
95 0.25
96 0.19
97 0.17
98 0.19
99 0.16
100 0.14
101 0.12
102 0.13
103 0.1
104 0.13
105 0.12
106 0.1
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.14
114 0.14
115 0.14
116 0.14
117 0.15
118 0.17
119 0.17
120 0.16
121 0.14
122 0.16
123 0.18
124 0.18
125 0.18
126 0.19
127 0.2
128 0.2
129 0.16
130 0.2
131 0.19
132 0.2
133 0.21
134 0.22
135 0.21
136 0.22
137 0.23
138 0.18
139 0.28
140 0.33
141 0.35
142 0.35
143 0.35
144 0.34
145 0.34
146 0.35
147 0.26
148 0.2
149 0.19
150 0.19
151 0.19
152 0.19
153 0.2
154 0.18
155 0.19
156 0.18
157 0.14
158 0.13
159 0.12
160 0.1
161 0.09
162 0.09
163 0.07
164 0.07
165 0.08
166 0.09
167 0.14
168 0.17
169 0.21
170 0.24
171 0.29
172 0.31
173 0.32
174 0.37
175 0.33
176 0.32
177 0.31
178 0.31
179 0.31
180 0.35
181 0.39
182 0.35
183 0.37
184 0.39
185 0.39
186 0.4
187 0.38
188 0.33
189 0.29
190 0.27
191 0.25
192 0.2
193 0.16
194 0.12
195 0.08
196 0.07
197 0.06
198 0.07
199 0.07
200 0.09
201 0.17
202 0.18
203 0.23
204 0.24
205 0.28
206 0.32
207 0.39
208 0.44
209 0.45
210 0.51
211 0.52
212 0.55
213 0.57
214 0.51
215 0.49
216 0.42
217 0.37
218 0.33
219 0.29
220 0.25
221 0.24
222 0.24
223 0.19
224 0.19
225 0.16
226 0.13
227 0.16
228 0.17
229 0.14
230 0.13
231 0.14
232 0.15
233 0.17
234 0.19
235 0.17
236 0.18
237 0.2
238 0.2
239 0.23
240 0.26
241 0.28