Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4Y7Y4

Protein Details
Accession A0A4Q4Y7Y4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-67IDPPPPRRAKRAPPRPECEDGBasic
NLS Segment(s)
PositionSequence
53-58RRAKRA
Subcellular Location(s) mito 12, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MRLSITPTLSLTLALSTSLIAATPANSGKGAAVRMSSKTEGLDWHTIDPPPPRRAKRAPPRPECEDGAGFEELCPQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.04
9 0.05
10 0.07
11 0.07
12 0.08
13 0.08
14 0.08
15 0.08
16 0.09
17 0.1
18 0.08
19 0.09
20 0.1
21 0.11
22 0.14
23 0.14
24 0.13
25 0.12
26 0.12
27 0.12
28 0.15
29 0.16
30 0.14
31 0.16
32 0.17
33 0.17
34 0.19
35 0.25
36 0.27
37 0.31
38 0.39
39 0.4
40 0.47
41 0.54
42 0.63
43 0.67
44 0.72
45 0.76
46 0.77
47 0.81
48 0.81
49 0.78
50 0.7
51 0.64
52 0.55
53 0.46
54 0.4
55 0.34
56 0.27
57 0.22
58 0.23