Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8PKJ0

Protein Details
Accession J8PKJ0    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MPQKPLKVTKKTKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLKKLKKSSSHydrophilic
NLS Segment(s)
PositionSequence
7-48KVTKKTKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLKKLKK
75-85KQLEKSKKAAK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKPLKVTKKTKDPRRITKKQKNLRKAAPLQLKSKKKSLQHLKKLKKSSSLTETTERLVASKVGHLELLRGTRKQLEKSKKAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.91
5 0.91
6 0.92
7 0.92
8 0.92
9 0.92
10 0.9
11 0.89
12 0.86
13 0.84
14 0.79
15 0.77
16 0.77
17 0.71
18 0.69
19 0.7
20 0.7
21 0.63
22 0.65
23 0.61
24 0.56
25 0.62
26 0.64
27 0.66
28 0.68
29 0.76
30 0.78
31 0.8
32 0.83
33 0.75
34 0.72
35 0.64
36 0.6
37 0.56
38 0.51
39 0.47
40 0.44
41 0.42
42 0.35
43 0.33
44 0.27
45 0.21
46 0.17
47 0.15
48 0.11
49 0.13
50 0.13
51 0.12
52 0.14
53 0.13
54 0.13
55 0.15
56 0.21
57 0.22
58 0.21
59 0.23
60 0.29
61 0.35
62 0.42
63 0.49
64 0.54
65 0.58